From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006489000
  • symbol?: trmE
  • description?: tRNA modification GTPase TrmE

      descriptions from strain specific annotations:

    • tRNA modification GTPase TrmE
    • GTPase and tRNA-U34 5-formylation enzyme TrmE
    • tRNA modification GTPase mnmE
    • tRNA (5-carboxymethylaminomethyl-2-thiouridylate) synthase
  • strand?: -
  • coordinates?: 6523994..6525373
  • synteny block?: BlockID0051960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2738 (trmE)
    N315:
    SA2501 (trmE)
    NCTC8325:
    Newman:
    NWMN_2612 (trmE)
    USA300_FPR3757:
    04-02981:
    SA2981_2651 (trmE)
    08BA02176:
    C248_2777
    11819-97:
    MS7_2716 (trmE)
    71193:
    ST398NM01_2757
    ECT-R 2:
    ECTR2_2563 (trmE)
    ED133:
    SAOV_2753c
    ED98:
    SAAV_2783 (trmE)
    HO 5096 0412:
    SAEMRSA15_26100
    JH1:
    SaurJH1_2791 (trmE)
    JH9:
    SaurJH9_2734 (trmE)
    JKD6008:
    SAA6008_02773 (trmE)
    JKD6159:
    SAA6159_02605 (trmE)
    LGA251:
    SARLGA251_24760 (mnmE)
    M013:
    M013TW_2698
    MRSA252:
    SAR2798 (trmE)
    MSHR1132:
    SAMSHR1132_25390
    MSSA476:
    SAS2594 (trmE)
    Mu3:
    SAHV_2696 (trmE)
    Mu50:
    SAV2712 (trmE)
    MW2:
    MW2630 (trmE)
    RF122:
    SAB2588c (trmE)
    ST398:
    SAPIG2757 (trmE)
    T0131:
    SAT0131_02994
    TCH60:
    HMPREF0772_10470 (trmE)
    TW20:
    SATW20_28500 (mnmE)
    USA300_TCH1516:
    USA300HOU_2715 (trmE)
    VC40:
    SAVC_12450 (trmE)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDLDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKHLLNDVPSHTINYGHIIDPES
    N315            MDLDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKHLLNDVPSHTINYGHIIDPES
    NCTC8325        MDLDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKHLLNDVPSHTINYGHIIDPES
    Newman          MDLDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKHLLNDVPSHTINYGHIIDPES
    USA300_FPR3757  MDLDTITSISTPMGEGAIGIVRLSGPQAVEIADKLYKGKHLLNDVPSHTINYGHIIDPES
                    ************************************************************

    COL             KEVIEEVMVSVLRAPKTFTREDIIEINCHGGILTINRVLELTMTYGARMAEPGEFTKRAF
    N315            KEVVEEVMVSVLRAPKTFTREDIIEINCHGGILTINRVLELTMTYGARMAEPGEFTKRAF
    NCTC8325        KEVVEEVMVSVLRAPKTFTREDIIEINCHGGILTINRVLELTMTYGARMAEPGEFTKRAF
    Newman          KEVIEEVMVSVLRAPKTFTREDIIEINCHGGILTINRVLELTMTYGARMAEPGEFTKRAF
    USA300_FPR3757  KEVIEEVMVSVLRAPKTFTREDIIEINCHGGILTINRVLELTMTYGARMAEPGEFTKRAF
                    ***:********************************************************

    COL             LNGRIDLSQAEAVMDFIRSKTDRASKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDY
    N315            LNGRIDLSQAEAVMDFIRSKTDRASKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDY
    NCTC8325        LNGRIDLSQAEAVMDFIRSKTDRASKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDY
    Newman          LNGRIDLSQAEAVMDFIRSKTDRASKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDY
    USA300_FPR3757  LNGRIDLSQAEAVMDFIRSKTDRASKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDY
                    ************************************************************

    COL             PEYDDVEDATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNN
    N315            PEYDDVEDATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNN
    NCTC8325        PEYDDVEDATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNN
    Newman          PEYDDVEDATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNN
    USA300_FPR3757  PEYDDVEDATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNN
                    ************************************************************

    COL             LIQDNKAIVTEVAGTTRDVLEEYVNVRGVPLRLVDTAGIRETEDIVEKIGVERSRKALSQ
    N315            LIQDNKAIVTEVAGTTRDVLEEYVNVRGVPLRLVDTAGIRETEDIVEKIGVERSRKALSQ
    NCTC8325        LIQDNKAIVTEVAGTTRDVLEEYVNVRGVPLRLVDTAGIRETEDIVEKIGVERSRKALSQ
    Newman          LIQDNKAIVTEVAGTTRDVLEEYVNVRGVPLRLVDTAGIRETEDIVEKIGVERSRKALSQ
    USA300_FPR3757  LIQDNKAIVTEVAGTTRDVLEEYVNVRGVPLRLVDTAGIRETEDIVEKIGVERSRKALSQ
                    ************************************************************

    COL             ADLILFVLNNNEALTQEDYTLYEVVKNEDVIVIVNKMDLEQNIDINEVKDMIGDTPLIQT
    N315            ADLILFVLNNNEALTQEDYTLYEVVKNEDVIVIVNKMDLEQNIDINEVKDMIGDTPLIQT
    NCTC8325        ADLILFVLNNNEALTQEDYTLYEVVKNEDVIVIVNKMDLEQNIDINEVKDMIGDTPLIQT
    Newman          ADLILFVLNNNEALTQEDYTLYEVVKNEDVIVIVNKMDLEQNIDINEVKDMIGDTPLIQT
    USA300_FPR3757  ADLILFVLNNNEALTQEDYTLYEVVKNEDVIVIVNKMDLEQNIDINEVKDMIGDTPLIQT
                    ************************************************************

    COL             SMLKQEGIDELEIQIRDLFFGGEVQNQDMTYVSNSRHISLLKQARQTIQDAIDAAESGVP
    N315            SMLKQEGIDELEIQIRDLFFGGEVQNQDMTYVSNSRHISLLKQARQTIQDAIDAAESGVP
    NCTC8325        SMLKQEGIDELEIQIRDLFFGGEVQNQDMTYVSNSRHISLLKQARQTIQDAIDAAESGVP
    Newman          SMLKQEGIDELEIQIRDLFFGGEVQNQDMTYVSNSRHISLLKQARQTIQDAIDAAESGVP
    USA300_FPR3757  SMLKQEGIDELEIQIRDLFFGGEVQNQDMTYVSNSRHISLLKQARQTIQDAIDAAESGVP
                    ************************************************************

    COL             MDMVQIDLTRTWEILGEIIGETASDELIDQLFSQFCLGK
    N315            MDMVQIDLTRTWEILGEIIGETASDELIDQLFSQFCLGK
    NCTC8325        MDMVQIDLTRTWEILGEIIGETASDELIDQLFSQFCLGK
    Newman          MDMVQIDLTRTWEILGEIIGETASDELIDQLFSQFCLGK
    USA300_FPR3757  MDMVQIDLTRTWEILGEIIGETASDELIDQLFSQFCLGK
                    ***************************************