Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0305 [new locus tag: SAUSA300_RS01625 ]
  • pan locus tag?: SAUPAN001223000
  • symbol: SAUSA300_0305
  • pan gene symbol?:
  • synonym:
  • product: formate/nitrite transporter family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_0305 [new locus tag: SAUSA300_RS01625 ]
  • symbol: SAUSA300_0305
  • product: formate/nitrite transporter family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 354436..355131
  • length: 696
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATGGCAGGATTTATTATCGGGATTATTACGGTCTTCGTATTATCAGTTAAAGCAACA
    CACGAACCAGATTTACCGCCAGGCATTGTGAATATGGCCAGTGCCATTACATTCAGCTTT
    GCGTTAGTACTCATTTTATTTACAAACTCCGAACTACTAACCAGTAACTTCATGTACTTT
    ACTGTAGGCCTGTATTATAAAGTAATTAAACCAACTAGAGTATTGAAAATATTTTTATTA
    TGCTTTGCAGGAAATATTTTAGGTGCTGCTATTTTATTTAGTTTCATGCGTTTTTCAAAT
    GTAATGACGCCAGATATGTTAAATCAGTTATCAGCAGTTATAGAGCATAAAACGTTGTCT
    ACTGGTTTTGTAAGTATATTAATGAAAGCGATCTTCGCCAATTTCTTTATCAATATTTCA
    TTAGTTATTGCCATGCAAATTGACGATGTACTCGCAAAAATGTTTGTCATGATGTTCGGT
    GTTACCATATTCGCCTTTATGGGTTATGAACACGTCGTTTACAACAGTTGCTTATTTATG
    GGTGGTTTAATTTATCAAGTTGATACATTGCACTTCATACCAGCTATTTCGAATATCGCT
    GCGGCTTTTATCGGTAACTATATTGGAGGCGGACTCATTATAGGTTTATTCTATGCTTAC
    TTGAATGATCATCATCAATTTTATAAAAATAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    696

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_0305 [new locus tag: SAUSA300_RS01625 ]
  • symbol: SAUSA300_0305
  • description: formate/nitrite transporter family protein
  • length: 231
  • theoretical pI: 7.65572
  • theoretical MW: 25709.6
  • GRAVY: 0.964069

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsAnionsformate/nitrite transporter (TIGR00790; HMM-score: 121.1)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsformate transporter FocA (TIGR04060; HMM-score: 99.1)
  • TheSEED:  
    formate/nitrite transporter family protein 
  • PFAM:
    no clan definedForm_Nir_trans; Formate/nitrite transporter (PF01226; HMM-score: 152.7)
    DUF2613; Protein of unknown function (DUF2613) (PF11021; HMM-score: 13.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 7
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.388
    • Ymax_pos: 20
    • Cmax: 0.268
    • Cmax_pos: 20
    • Smax: 0.714
    • Smax_pos: 18
    • Smean: 0.497
    • D: 0.43
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MMAGFIIGIITVFVLSVKATHEPDLPPGIVNMASAITFSFALVLILFTNSELLTSNFMYFTVGLYYKVIKPTRVLKIFLLCFAGNILGAAILFSFMRFSNVMTPDMLNQLSAVIEHKTLSTGFVSILMKAIFANFFINISLVIAMQIDDVLAKMFVMMFGVTIFAFMGYEHVVYNSCLFMGGLIYQVDTLHFIPAISNIAAAFIGNYIGGGLIIGLFYAYLNDHHQFYKNN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: Rex
    Rex (TF) important in Energy metabolism  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]