From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1032 [new locus tag: SAUSA300_RS05555 ]
  • pan locus tag?: SAUPAN003363000
  • symbol: SAUSA300_1032
  • pan gene symbol?: isdE
  • synonym:
  • product: putative iron compound ABC transporter iron compound-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1032 [new locus tag: SAUSA300_RS05555 ]
  • symbol: SAUSA300_1032
  • product: putative iron compound ABC transporter iron compound-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1127538..1128386
  • length: 849
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    GTGATAAGCGTCGTTATCTTAACCAGCTGTCAATCTTCCAGTTCTCAAGAATCAACTAAA
    TCCGGCGAATTCAGAATCGTACCAACAACTGTTGCATTGACAATGACATTGGACAAATTG
    GATTTACCAATTGTCGGCAAACCCACGTCATATAAGACATTGCCTAATCGTTATAAAGAT
    GTACCGGAAATTGGTCAACCAATGGAGCCGAATGTTGAAGCTGTTAAAAAGTTAAAACCA
    ACACATGTTTTGAGTGTGTCAACGATTAAAGATGAAATGCAACCATTTTACAAACAATTA
    AATATGAAAGGCTACTTTTATGATTTTGATAGTTTAAAAGGGATGCAAAAGTCGATTACA
    CAATTAGGTGATCAATTTAATCGTAAAGCACAAGCAAAAGAATTAAATGACCATTTAAAT
    TCTGTAAAGCAAAAAATTGAAAATAAAGCAGCTAAACAAAAGAAACATCCCAAAGTATTA
    ATATTAATGGGTGTACCGGGTAGCTATTTAGTAGCAACTGATAAATCATATATTGGTGAT
    TTAGTTAAAATAGCAGGTGGAGAAAATGTTATTAAAGTGAAAGATCGTCAATATATTTCG
    TCTAATACTGAAAATTTGTTGAATATCAATCCAGATATTATTTTACGATTACCACACGGA
    ATGCCTGAAGAAGTTAAGAAAATGTTTCAAAAAGAATTTAAACAAAATGATATTTGGAAA
    CATTTTAAAGCTGTGAAAAATAATCATGTTTATGACTTAGAGGAAGTGCCATTCGGTATT
    ACAGCAAATGTTGATGCTGATAAGGCAATGACTCAATTATATGATTTATTTTATAAGGAT
    AAAAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    849

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1032 [new locus tag: SAUSA300_RS05555 ]
  • symbol: SAUSA300_1032
  • description: putative iron compound ABC transporter iron compound-binding protein
  • length: 282
  • theoretical pI: 9.80489
  • theoretical MW: 32056.9
  • GRAVY: -0.50922

Function[edit source | edit]

  • TIGRFAM:
    heme ABC transporter, heme-binding protein isdE (TIGR03659; HMM-score: 405.6)
    and 2 more
    putative ABC transporter PGF-CTERM-modified substrate-binding protein (TIGR04281; HMM-score: 43.8)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtwin arginine-targeting protein translocase TatB (TIGR01410; HMM-score: 15.1)
  • TheSEED:  
    Iron acquisition and metabolismIron acquisition and metabolism - no subcategoryHeme, hemin uptake and utilization systems in GramPositives Heme transporter IsdDEF, lipoprotein IsdE 
  • PFAM:
    Chelatase (CL0043) Peripla_BP_2; Periplasmic binding protein (PF01497; HMM-score: 138.8)
    and 4 more
    no clan definedMuted; Organelle biogenesis, Muted-like protein (PF14942; HMM-score: 17.2)
    HAD (CL0137) NT5C; 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C) (PF06941; HMM-score: 16.1)
    no clan definedDUF2098; Uncharacterized protein conserved in archaea (DUF2098) (PF09871; HMM-score: 15)
    PK_TIM (CL0151) ICL; Isocitrate lyase family (PF00463; HMM-score: 13.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: heme b
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.329
    • Ymax_pos: 18
    • Cmax: 0.22
    • Cmax_pos: 18
    • Smax: 0.598
    • Smax_pos: 14
    • Smean: 0.476
    • D: 0.386
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MISVVILTSCQSSSSQESTKSGEFRIVPTTVALTMTLDKLDLPIVGKPTSYKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFDSLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYLVATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQKEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYKDKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SAUSA300_1448 (repression) regulon (Fur*)
    Fur*(TF)important in Iron homeostasis;RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]