Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1703 [new locus tag: SAUSA300_RS09300 ]
- pan locus tag?: SAUPAN004440000
- symbol: SAUSA300_1703
- pan gene symbol?: —
- synonym:
- product: rhodanese-like domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1703 [new locus tag: SAUSA300_RS09300 ]
- symbol: SAUSA300_1703
- product: rhodanese-like domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1884794..1885105
- length: 312
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913743 NCBI
- RefSeq: YP_494397 NCBI
- BioCyc: GH3C-1695 BioCyc
- MicrobesOnline: 1293218 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAGTCAATTACTACAGATGAATTAAAAAATAAACTTTTAGAATCTAAACCAGTTCAA
ATTGTTGATGTTCGTACTGATGAAGAAACAGCAATGGGATATATTCCTAATGCAAAGTTA
ATTCCAATGGATACCATTCCGGATAATTTAAATTCATTTAATAAAAATGAAATATATTAT
ATTGTATGTGCTGGTGGAGTTCGAAGCGCTAAAGTTGTAGAATATTTAGAGGCAAATGGC
ATTGATGCCGTAAATGTCGAAGGCGGCATGCACGCATGGGGCGATGAAGGTTTGGAAATA
AAAAGTATTTAA60
120
180
240
300
312
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1703 [new locus tag: SAUSA300_RS09300 ]
- symbol: SAUSA300_1703
- description: rhodanese-like domain-containing protein
- length: 103
- theoretical pI: 4.30237
- theoretical MW: 11343.9
- GRAVY: -0.220388
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 24)thiazole biosynthesis domain (TIGR04271; HMM-score: 24)and 2 moreProtein synthesis tRNA and rRNA base modification selenouridine synthase, SelU N-terminal-like subunit (TIGR04568; HMM-score: 13.1)phage shock operon rhodanese PspE (TIGR02981; EC 2.8.1.1; HMM-score: 12.9)
- TheSEED :
- Ankyrin
- Rhodanese domain protein
Potassium metabolism Potassium metabolism - no subcategory Glutathione-regulated potassium-efflux system and associated functions Rhodanese-like domain proteinand 1 more - PFAM: Phosphatase (CL0031) Rhodanese; Rhodanese-like domain (PF00581; HMM-score: 42.9)and 2 more5_3_exonuc_C (CL0464) RNaseH_C; T4 RNase H, C terminal (PF09293; HMM-score: 13.4)NADP_Rossmann (CL0063) CoA_binding_2; CoA binding domain (PF13380; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.01276
- TAT(Tat/SPI): 0.000684
- LIPO(Sec/SPII): 0.001797
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYYIVCAGGVRSAKVVEYLEANGIDAVNVEGGMHAWGDEGLEIKSI
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.