Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS00160 [old locus tag: SAUSA300_0031 ]
  • pan locus tag?: SAUPAN000100000
  • symbol: SAUSA300_RS00160
  • pan gene symbol?: maoC
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS00160 [old locus tag: SAUSA300_0031 ]
  • symbol: SAUSA300_RS00160
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 38653..39081
  • length: 429
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (38653..39081) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAATACGATGATTTTATAGTAGGAGAAACATTCAAAACAAAAAGCCTTCATATTACA
    GAAGAAGAAATTATCCAATTTGCAACAACTTTTGATCCTCAATATATGCATATAGATAAA
    GAAAAAGCAGAACAAAGTAGATTTAAAGGTATCATTGCATCTGGCATGCATACACTTTCA
    ATATCATTTAAATTATGGGTAGAAGAAGGTAAATACGGAGAAGAAGTTGTAGCAGGAACA
    CAAATGAATAACGTTAAATTTATTAAACCTGTATACCCAGGTAATACATTGTACGTTATC
    GCTGAAATTACAAATAAGAAATCCATAAAAAAAGAAAATGGACTCGTTACAGTGTCACTT
    TCAACATACAATGAAAATGAAGAAATTGTATTTAAGGGAGAAGTAACAGCACTTATTAAT
    AATTCATAA
    60
    120
    180
    240
    300
    360
    420
    429

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS00160 [old locus tag: SAUSA300_0031 ]
  • symbol: SAUSA300_RS00160
  • description: hypothetical protein
  • length: 142
  • theoretical pI: 5.2803
  • theoretical MW: 16136.3
  • GRAVY: -0.311268

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    phenylacetic acid degradation protein paaN (TIGR02278; HMM-score: 60.4)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisbeta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ (TIGR01750; EC 4.2.1.-; HMM-score: 17.9)
  • TheSEED:
  • PFAM:
    HotDog (CL0050) MaoC_dehydratas; MaoC like domain (PF01575; HMM-score: 112.9)
    MaoC_dehydrat_N; N-terminal half of MaoC dehydratase (PF13452; HMM-score: 29.8)
    FabA; FabA-like domain (PF07977; HMM-score: 16.8)
    4HBT; Thioesterase superfamily (PF03061; HMM-score: 15)
    ADP-ribosyl (CL0084) NADase_NGA; Nicotine adenine dinucleotide glycohydrolase (NADase) (PF07461; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.107
    • Ymax_pos: 44
    • Cmax: 0.12
    • Cmax_pos: 44
    • Smax: 0.134
    • Smax_pos: 2
    • Smean: 0.076
    • D: 0.095
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446795350 NCBI
  • RefSeq: WP_000872606 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKYDDFIVGETFKTKSLHITEEEIIQFATTFDPQYMHIDKEKAEQSRFKGIIASGMHTLSISFKLWVEEGKYGEEVVAGTQMNNVKFIKPVYPGNTLYVIAEITNKKSIKKENGLVTVSLSTYNENEEIVFKGEVTALINNS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS00160 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]