From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS00280 [old locus tag: SAUSA300_0055 ]
  • pan locus tag?: SAUPAN000809000
  • symbol: SAUSA300_RS00280
  • pan gene symbol?: adhC
  • synonym:
  • product: alcohol dehydrogenase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS00280 [old locus tag: SAUSA300_0055 ]
  • symbol: SAUSA300_RS00280
  • product: alcohol dehydrogenase
  • replicon: chromosome
  • strand: +
  • coordinates: 64095..65222
  • length: 1128
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (64095..65222) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    GTGAAAACTAGAGCAGCAGTTTTACATGAAATGGGGGCTAAAAAGCCCTATAAAGAATCT
    AAACCTTTAAAAATTGAATACTTAGAACTTGATAATCCTAGCGAACACGAAGTATTAATT
    AAAATTCATGCAGCTGGATTATGTCACTCTGATTTGTCAGTAATTAATGGTAACAGACCT
    AGACCTTTACCTATGGCACTTGGTCATGAAGCTTCCGGTGAAGTAATTAAAGTTGGAAAA
    GCTGTTACAAGAGTTAGCGAAGGAGATCATGTGGTATGCACATTTATTCCCAGTTGTGGA
    AAATGTATCCCATGTAAAGAAGGACGTCCTGCATTATGTGAAAACGGAGCAATATCTAAT
    GAAAAAGGCGAAATGTTAGAGGGAGGGATGCGTTTATCTAATGATGAAGGAAAAGTATAT
    CATCACTTGGGGATATCAGGTTTTGCTGAATATTCTGTTGTCTCTGAAAACTCTATAGTT
    AAAATTGATAAAAAAATACCTTTTGAACGTGCAGCTGCATTTGGTTGTGCTATTATCACA
    GGTATCGGTGCTGTGGTGAATACAGCCCAAATTCGTTCTGGTAGTAATGTAGCGGTTGTT
    GGTTTAGGAGGTATTGGATTGAATGCTATTATTGGAGCTAAACTAGCGGGAGCCAATGAA
    ATTATTGCTTTAGATATTAACGAAGATAAATTTGAATTAGCAAAGCAATTTGGGGCTACA
    GCAACATTTAATTCAAGCGATAAAGATATCGATGAGCAAATTAAAGAATATATTCCTGGC
    GGAGTAGAATATGCTTTTGAAACAGCGGGTGTAGTGCCAGCTATGAAAGTTGCTTATCAG
    ATTACTAAACGAGGGGGGACAACTGTAACAACAGGACTGCCTAATCCTAAAGATAATTTT
    TCTTTCCCTCAAGTTACTTTAGCGGCTGAAGAACGTACCATTAAAGGATCATATGTAGGA
    AGTTGTGTACCTGACAGAGATATACCAAGGTTCGTTAATCTATACAACCAAGGACGTTTA
    AATATTGATTCACTCATCAGTGAGGTTATCACTTTAGATGAAATTAATGAGGGATTTGAT
    CGTTTGTCTAATGGTGAAGTAGGTAGAATTATAATGAAGATGCATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1128

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS00280 [old locus tag: SAUSA300_0055 ]
  • symbol: SAUSA300_RS00280
  • description: alcohol dehydrogenase
  • length: 375
  • theoretical pI: 6.25011
  • theoretical MW: 40253.9
  • GRAVY: -0.1096

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificityNDMA-dependent alcohol dehydrogenase, Rxyl_3153 family (TIGR03989; EC 1.1.99.36; HMM-score: 332.2)
    Cellular processesCellular processesDetoxificationS-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase (TIGR02818; EC 1.1.1.1,1.1.1.284; HMM-score: 306.3)
    MetabolismEnergy metabolismFermentationS-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase (TIGR02818; EC 1.1.1.1,1.1.1.284; HMM-score: 306.3)
    Cellular processesCellular processesDetoxificationS-(hydroxymethyl)mycothiol dehydrogenase (TIGR03451; EC 1.1.1.306; HMM-score: 285.5)
    MetabolismEnergy metabolismAmino acids and aminesL-threonine 3-dehydrogenase (TIGR00692; EC 1.1.1.103; HMM-score: 142.5)
    putative phosphonate catabolism associated alcohol dehydrogenase (TIGR03366; HMM-score: 134.1)
    6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase (TIGR03201; EC 1.1.1.-; HMM-score: 123.7)
    Unknown functionEnzymes of unknown specificityputative NAD(P)H quinone oxidoreductase, PIG3 family (TIGR02824; HMM-score: 89.2)
    MetabolismCentral intermediary metabolismOne-carbon metabolismformaldehyde dehydrogenase, glutathione-independent (TIGR02819; EC 1.2.1.46; HMM-score: 87.5)
    MetabolismEnergy metabolismFermentationzinc-binding alcohol dehydrogenase family protein (TIGR02822; EC 1.-.-.-; HMM-score: 60.8)
    crotonyl-CoA carboxylase/reductase (TIGR01751; EC 1.3.1.85; HMM-score: 58.4)
    Unknown functionEnzymes of unknown specificityputative quinone oxidoreductase, YhdH/YhfP family (TIGR02823; HMM-score: 35.3)
    MetabolismEnergy metabolismFermentationzinc-binding alcohol dehydrogenase family protein (TIGR02817; HMM-score: 28.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphyllchlorophyll synthesis pathway protein BchC (TIGR01202; HMM-score: 23.7)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 102.9)
    GroES (CL0296) ADH_N; Alcohol dehydrogenase GroES-like domain (PF08240; HMM-score: 100.9)
    NADP_Rossmann (CL0063) AlaDh_PNT_C; Alanine dehydrogenase/PNT, C-terminal domain (PF01262; HMM-score: 21)
    Glu_dehyd_C; Glucose dehydrogenase C-terminus (PF16912; HMM-score: 19.5)
    ADH_zinc_N_2; Zinc-binding dehydrogenase (PF13602; HMM-score: 18.2)
    no clan definedNADH_4Fe-4S; NADH-ubiquinone oxidoreductase-F iron-sulfur binding region (PF10589; HMM-score: 15.3)
    NADP_Rossmann (CL0063) UDPG_MGDP_dh_N; UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain (PF03721; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.126
    • Ymax_pos: 13
    • Cmax: 0.113
    • Cmax_pos: 69
    • Smax: 0.184
    • Smax_pos: 7
    • Smean: 0.158
    • D: 0.139
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446779903 NCBI
  • RefSeq: WP_000857159 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKTRAAVLHEMGAKKPYKESKPLKIEYLELDNPSEHEVLIKIHAAGLCHSDLSVINGNRPRPLPMALGHEASGEVIKVGKAVTRVSEGDHVVCTFIPSCGKCIPCKEGRPALCENGAISNEKGEMLEGGMRLSNDEGKVYHHLGISGFAEYSVVSENSIVKIDKKIPFERAAAFGCAIITGIGAVVNTAQIRSGSNVAVVGLGGIGLNAIIGAKLAGANEIIALDINEDKFELAKQFGATATFNSSDKDIDEQIKEYIPGGVEYAFETAGVVPAMKVAYQITKRGGTTVTTGLPNPKDNFSFPQVTLAAEERTIKGSYVGSCVPDRDIPRFVNLYNQGRLNIDSLISEVITLDEINEGFDRLSNGEVGRIIMKMH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS00280 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]