Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS04340 [old locus tag: SAUSA300_0804 ]
- pan locus tag?: SAUPAN002848000
- symbol: SAUSA300_RS04340
- pan gene symbol?: —
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS04340 [old locus tag: SAUSA300_0804 ]
- symbol: SAUSA300_RS04340
- product: transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 885796..886059
- length: 264
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (885796..886059) NCBI
- BioCyc: see SAUSA300_0804
- MicrobesOnline: see SAUSA300_0804
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGGTACTAAATTTAAAAAGATTGAGAGCGGAAAGAATAGCTTGTGGTATTACGCAAGAT
GAAATGGCTCACAAAATGGGGTGGAAAACAAGAACGCCTTATGCAAAGAGAGAAAATGGA
ATAGTAGATATTGGAGCGAATGAATTTATTAAAATGGCAAAAATATTAGGTTATGAAACA
AATAACCTAGACATTTTTTTTACCAATAACGTTCCCGGAAAAGAACGAAAAAACATCTTA
AAAGGAGGTGAATTAAATGTCTAG60
120
180
240
264
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS04340 [old locus tag: SAUSA300_0804 ]
- symbol: SAUSA300_RS04340
- description: transcriptional regulator
- length: 87
- theoretical pI: 10.2199
- theoretical MW: 9908.51
- GRAVY: -0.45977
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 16.1)
- TheSEED: see SAUSA300_0804
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 33.2)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 27.6)and 2 moreHTH_31; Helix-turn-helix domain (PF13560; HMM-score: 22)Pou; Pou domain - N-terminal to homeobox domain (PF00157; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00865
- TAT(Tat/SPI): 0.000447
- LIPO(Sec/SPII): 0.002132
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446165994 NCBI
- RefSeq: WP_000243849 NCBI
- UniProt: see SAUSA300_0804
⊟Protein sequence[edit | edit source]
- MVLNLKRLRAERIACGITQDEMAHKMGWKTRTPYAKRENGIVDIGANEFIKMAKILGYETNNLDIFFTNNVPGKERKNILKGGELNV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.