NCBI: 02-MAR-2017
Contents
⊟Summary[edit source | edit]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07805 [old locus tag: SAUSA300_1430 ]
- pan locus tag?: SAUPAN001309000
- symbol: SAUSA300_RS07805
- pan gene symbol?: —
- synonym:
- product: helix-turn-helix domain-containing protein
⊟Genome View[edit source | edit]
⊟Gene[edit source | edit]
⊟General[edit source | edit]
- type: CDS
- locus tag: SAUSA300_RS07805 [old locus tag: SAUSA300_1430 ]
- symbol: SAUSA300_RS07805
- product: helix-turn-helix domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1586683..1586946
- length: 264
- essential: unknown
⊟Accession numbers[edit source | edit]
- Location: NC_007793 (1586683..1586946) NCBI
- MicrobesOnline:
⊟Phenotype[edit source | edit]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit source | edit]
- 1
61
121
181
241ATGCCAAAAATCATAGTACCACCAACACCAGAAAACACATATAGAGGCGAAGAAAAATTT
GTGAAAAAGTTATACGCAACACCTACACAAATCCATCAATTGTTTGGAGTATGTAGAAGT
ACAGTATACAACTGGTTGAAATATTACCGCAAAGATAATTTAGGTGTAGAAAATTTATAC
ATTGATTATTCACCAACAGGCACTCTGATTAATATTTCTAAATTGGAAGAGTATTTGATC
AGAAAGCATAAAAAATGGTATTAG60
120
180
240
264
⊟Protein[edit source | edit]
⊟General[edit source | edit]
- locus tag: SAUSA300_RS07805 [old locus tag: SAUSA300_1430 ]
- symbol: SAUSA300_RS07805
- description: helix-turn-helix domain-containing protein
- length: 87
- theoretical pI: 9.82716
- theoretical MW: 10444.1
- GRAVY: -0.611494
⊟Function[edit source | edit]
- reaction:
- TIGRFAM:
- TheSEED:
- PFAM: HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 29.6)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 21.9)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 21.3)HTH_OrfB_IS605; Helix-turn-helix domain (PF12323; HMM-score: 18)Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 17.5)HTH_Tnp_IS630; Transposase (PF01710; HMM-score: 17.1)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 16.5)CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 13.8)HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 12.8)Phage_AlpA; Prophage CP4-57 regulatory protein (AlpA) (PF05930; HMM-score: 12)
⊟Structure, modifications & interactions[edit source | edit]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit source | edit]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- Ymax: 0.137
- Ymax_pos: 17
- Cmax: 0.108
- Cmax_pos: 40
- Smax: 0.225
- Smax_pos: 11
- Smean: 0.16
- D: 0.146
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit source | edit]
⊟Protein sequence[edit source | edit]
- MPKIIVPPTPENTYRGEEKFVKKLYATPTQIHQLFGVCRSTVYNWLKYYRKDNLGVENLYIDYSPTGTLINISKLEEYLIRKHKKWY
⊟Experimental data[edit source | edit]
- experimentally validated: no data available
⊟Expression & Regulation[edit source | edit]
⊟Operon[edit source | edit]
- SAUSA300_RS07805 no polycistronic organisation predicted
⊟Regulation[edit source | edit]
- sigma factor:
- regulator:
⊟Transcription pattern[edit source | edit]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit source | edit]
- Aureolib: no data available
⊟Protein stability[edit source | edit]
- half-life: no data available
⊟Biological Material[edit source | edit]
⊟Mutants[edit source | edit]
⊟Expression vector[edit source | edit]
⊟lacZ fusion[edit source | edit]
⊟GFP fusion[edit source | edit]
⊟two-hybrid system[edit source | edit]
⊟FLAG-tag construct[edit source | edit]
⊟Antibody[edit source | edit]
⊟Other Information[edit source | edit]
You are kindly invited to share additional interesting facts.
⊟Literature[edit source | edit]
⊟References[edit source | edit]
⊟Relevant publications[edit source | edit]