From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS09205 [old locus tag: SAUSA300_1684 ]
  • pan locus tag?: SAUPAN004405000
  • symbol: SAUSA300_RS09205
  • pan gene symbol?:
  • synonym:
  • product: membrane protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS09205 [old locus tag: SAUSA300_1684 ]
  • symbol: SAUSA300_RS09205
  • product: membrane protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1856424..1857623
  • length: 1200
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (1856424..1857623) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    ATGACGCAGCAACAAAATGATAAAAGAACATTAAAAAATAAACACACTTATCAAAATGAA
    CCACTACCAAACCGTAAAGATTTTGTTGTTAGTTTTATAACTGGCGCGCTTGTTGGTTCA
    GCTTTAGGTTTGTATTTTAAAAATAAAGTTTATCAAAAAGCAGATGATTTAAAAGTCAAA
    GAACAAGAACTGTCGCAAAAGTTTGAAGAAAGAAAAACGCAACTTGAAGAAACGGTTGCC
    TATACAAAAGAACGTGTTGAAGGATTTTTAAACAAATCTAAAAATGAGCAAGCGGCATTA
    AAGGCACAACAAGCAGCGATAAAAGAAGAAGCAAGTGCAAATAATTTGAGTGATACATCA
    CAAGAGGCACAAGAGATTCAAGAAGCTAAAAAAGAAGCACAAGCAGAAACAGATAAAAGT
    GCAGCTGTATCAAATGAAGAACCAAAAGCAGTGGCATTGAAAGCACAACAAGCAGCGATA
    AAAGAAGAAGCAAGTGCAAATAATTTAAGTGATATATCACAAGAGGCACAAGAGGTTCAA
    GAAGCTAAAAAAGAAGCACAAGCAGAGAAAGACAGTGACACATTAACTAAAGATGCAAGT
    GCAGCAAAGGTAGAAGTATCAAAACCAGAGTCACAAGCTGAAAGATTAGCAAACGCTGCA
    AAACAGAAGCAAGCTAAATTAACACCAGGTTCAAAAGAGAGTCAATTAACTGAAGCGTTA
    TTTGCAGAAAAACCAGTTGCTAAAAATGACTTGAAAGAAATTCCTCAATTAGTTACTAAA
    AAGAATGATGTATCAGAGACAGAGACGGTTAATATAGATAATAAAGACACTGTTAAACAA
    AAAGAAGCTAAATTTGAAAATGGTGTTATTACACGTAAAGCTGATGAAAAAACAACTAAT
    AATACAGCTGTTGACAAGAAATCAGGTAAACAATCTAAAAAAACAACACCTTCAAATAAA
    CGAAATGCATCAAAAGCATCTACAAATAAAACTTCAGGTCAGAAAAAGCAACATAATAAG
    AAATCATCACAAGGTGCAAAGAAACAAAGTAGTTCAAGTAAGTCAACTCAAAAGAATAAT
    CAAACTAGTAATAAGAATTCAAAAACAACAAATGCTAAATCATCCAATGCATCAAAAACG
    CCAAATGCTAAAGTTGAGAAAGCTAAAAGTAAAATAGAGAAACGTACATTCAATGACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS09205 [old locus tag: SAUSA300_1684 ]
  • symbol: SAUSA300_RS09205
  • description: membrane protein
  • length: 399
  • theoretical pI: 10.2731
  • theoretical MW: 43925.4
  • GRAVY: -1.25414

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsUnknown substratetransport protein (TIGR00833; HMM-score: 3.5)
  • TheSEED:
  • PFAM:
    no clan definedPeptidase_M24; Metallopeptidase family M24 (PF00557; HMM-score: 9.2)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 0.11
    • Cellwall Score: 9.25
    • Extracellular Score: 0.63
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.203
    • Ymax_pos: 55
    • Cmax: 0.216
    • Cmax_pos: 55
    • Smax: 0.318
    • Smax_pos: 4
    • Smean: 0.18
    • D: 0.194
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446116043 NCBI
  • RefSeq: WP_000193898 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTQQQNDKRTLKNKHTYQNEPLPNRKDFVVSFITGALVGSALGLYFKNKVYQKADDLKVKEQELSQKFEERKTQLEETVAYTKERVEGFLNKSKNEQAALKAQQAAIKEEASANNLSDTSQEAQEIQEAKKEAQAETDKSAAVSNEEPKAVALKAQQAAIKEEASANNLSDISQEAQEVQEAKKEAQAEKDSDTLTKDASAAKVEVSKPESQAERLANAAKQKQAKLTPGSKESQLTEALFAEKPVAKNDLKEIPQLVTKKNDVSETETVNIDNKDTVKQKEAKFENGVITRKADEKTTNNTAVDKKSGKQSKKTTPSNKRNASKASTNKTSGQKKQHNKKSSQGAKKQSSSSKSTQKNNQTSNKNSKTTNAKSSNASKTPNAKVEKAKSKIEKRTFND

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS09205 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]