Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS10890
- pan locus tag?:
- symbol: SAUSA300_RS10890
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS10890
- symbol: SAUSA300_RS10890
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2138920..2139132
- length: 213
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2138920..2139132) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACAGACGATAATGTCAATGATCATATTATAAAGAATCACATAGAAATGATTGTTGAC
AGATTAGCGACCGATAAAGAGTTTTATATTTTTGACTCCCTTATACAAGGACTTAGTTAT
CAAGATATTAGTAGTGCCTTAGATTGTTCAGAACAATCTGTAATATTATGGTATGAAACC
ATATTAGATAAAATTGTGGGGGTGATAAAATGA60
120
180
213
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS10890
- symbol: SAUSA300_RS10890
- description: hypothetical protein
- length: 70
- theoretical pI: 4.06289
- theoretical MW: 8077.13
- GRAVY: 0.0471429
⊟Function[edit | edit source]
- TIGRFAM: RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 19)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 15.4)and 4 moreRNA polymerase sigma factor RpoE (TIGR02939; HMM-score: 13.2)Cellular processes Sporulation and germination RNA polymerase sigma-H factor (TIGR02859; HMM-score: 13.1)Transcription Transcription factors RNA polymerase sigma-H factor (TIGR02859; HMM-score: 13.1)RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 12.4)
- TheSEED:
- PFAM: HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 22.4)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 18.6)and 1 moreHTH_23; Homeodomain-like domain (PF13384; HMM-score: 15.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003751
- TAT(Tat/SPI): 0.000247
- LIPO(Sec/SPII): 0.000511
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTDDNVNDHIIKNHIEMIVDRLATDKEFYIFDSLIQGLSYQDISSALDCSEQSVILWYETILDKIVGVIK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.