From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS11195
  • pan locus tag?:
  • symbol: SAUSA300_RS11195
  • pan gene symbol?:
  • synonym:
  • product: potassium-transporting ATPase subunit F

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS11195
  • symbol: SAUSA300_RS11195
  • product: potassium-transporting ATPase subunit F
  • replicon: chromosome
  • strand: -
  • coordinates: 2197276..2197386
  • length: 111
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (2197276..2197386) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    ATGTTGTTGTGTTGTAAGGAGGTTATGGCAATGCTCATCGTTTTATTACTGGTAGTTATT
    GCATTAGTTTTGTATTTATTTTATGCCTTAATTCGTAGTGAAAAATTTTAG
    60
    111

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS11195
  • symbol: SAUSA300_RS11195
  • description: potassium-transporting ATPase subunit F
  • length: 36
  • theoretical pI: 8.21128
  • theoretical MW: 4176.38
  • GRAVY: 1.98611

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundsK+-transporting ATPase, F subunit (TIGR02115; EC 3.6.3.12; HMM-score: 31.4)
  • TheSEED:
  • PFAM:
    no clan definedPotass_KdpF; F subunit of K+-transporting ATPase (Potass_KdpF) (PF09604; HMM-score: 35.3)
    P12; Virus attachment protein p12 family (PF12669; HMM-score: 16.2)
    FixQ; Cbb3-type cytochrome oxidase component FixQ (PF05545; HMM-score: 12.9)
    TPR (CL0020) HemY_N; HemY protein N-terminus (PF07219; HMM-score: 11.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.19
    • Ymax_pos: 11
    • Cmax: 0.107
    • Cmax_pos: 36
    • Smax: 0.5
    • Smax_pos: 3
    • Smean: 0.353
    • D: 0.254
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 487705409 NCBI
  • RefSeq: WP_001789641 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLLCCKEVMAMLIVLLLVVIALVLYLFYALIRSEKF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS11195 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]