From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS12230 [old locus tag: SAUSA300_2216 ]
  • pan locus tag?: SAUPAN005722000
  • symbol: SAUSA300_RS12230
  • pan gene symbol?:
  • synonym:
  • product: MarR family transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS12230 [old locus tag: SAUSA300_2216 ]
  • symbol: SAUSA300_RS12230
  • product: MarR family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 2386471..2386911
  • length: 441
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (2386471..2386911) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGCTATCACAAGAATTTTTCAATAGTTTTATAACAATATATCGCCCCTATTTAAAATTA
    GCCGAGCCGATTTTAGAAAAACACAATATATATTATGGCCAATGGTTAATCTTACGCGAT
    ATCGCTAAACATCAGCCCACTACTCTCATTGAAATTTCACATAGACGTGCAATTGAAAAG
    CCTACTGCAAGAAAAACTTTAAAAGCTCTAATAGAAAATGACCTTATAACAGTAGAAAAC
    AGTTTAGAGGATAAACGACAAAAGTTTTTAACTTTAACACCTAAAGGGCATGAATTATAT
    GAGATTGTTTGTCTTGATGTACAAAAGCTCCAACAAGCAGTAGTTGCCAAAACAAACATT
    TCGCAAGATCAAATGCAAGAAACCATAAATGTGATGAATCAAATTCATGAAATATTATTA
    AGGGAGGCACACAATGACTAA
    60
    120
    180
    240
    300
    360
    420
    441

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS12230 [old locus tag: SAUSA300_2216 ]
  • symbol: SAUSA300_RS12230
  • description: MarR family transcriptional regulator
  • length: 146
  • theoretical pI: 7.16214
  • theoretical MW: 17179.8
  • GRAVY: -0.372603

Function[edit source | edit]

  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 50.4)
    and 4 more
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 17)
    EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 13.1)
    Signal transductionRegulatory functionsDNA interactionsbeta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family (TIGR02431; HMM-score: 12.7)
    putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 12.2)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 40.9)
    MarR; MarR family (PF01047; HMM-score: 38.5)
    and 9 more
    MarR_2; MarR family (PF12802; HMM-score: 29.1)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 17.8)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.5)
    HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 16.3)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 14.7)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.5)
    Replic_Relax; Replication-relaxation (PF13814; HMM-score: 14.3)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 14.2)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 14.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.094
    • Ymax_pos: 68
    • Cmax: 0.119
    • Cmax_pos: 58
    • Smax: 0.102
    • Smax_pos: 63
    • Smean: 0.067
    • D: 0.083
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446873803 NCBI
  • RefSeq: WP_000951059 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLSQEFFNSFITIYRPYLKLAEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLREAHND

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAUSA300_RS12230 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]