Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS12390 [old locus tag: SAUSA300_2245 ]
- pan locus tag?: SAUPAN005760000
- symbol: SAUSA300_RS12390
- pan gene symbol?: sarR
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS12390 [old locus tag: SAUSA300_2245 ]
- symbol: SAUSA300_RS12390
- product: transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 2410700..2411047
- length: 348
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2410700..2411047) NCBI
- BioCyc: see SAUSA300_2245
- MicrobesOnline: see SAUSA300_2245
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAGTAAAATTAATGACATTAATGATTTAGTCAACGCAACATTTCAAGTTAAGAAGTTT
TTCAGAGATACAAAAAAGAAGTTCAATTTGAACTATGAAGAAATTTATATTTTAAATCAT
ATTTTAAGAAGTGAGTCTAACGAAATCTCATCTAAAGAGATTGCTAAGTGCTCAGAGTTC
AAACCTTACTATTTAACTAAAGCTTTACAAAAGCTAAAAGATTTAAAATTGTTATCAAAG
AAAAGAAGTTTACAAGACGAAAGAACAGTTATTGTTTATGTTACAGATACACAAAAAGCA
AATATTCAAAAACTGATTTCAGAATTAGAAGAATACATTAAAAATTAA60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS12390 [old locus tag: SAUSA300_2245 ]
- symbol: SAUSA300_RS12390
- description: transcriptional regulator
- length: 115
- theoretical pI: 9.86544
- theoretical MW: 13668.7
- GRAVY: -0.623478
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 104.4)and 4 morehomoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 26.5)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15)mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 14.7)Transport and binding proteins Unknown substrate efflux transporter, putative, hydrophobe/amphiphile efflux-3 (HAE3) family (TIGR00921; HMM-score: 11)
- TheSEED: see SAUSA300_2245
- PFAM: HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 30.5)and 7 moreRrf2; Transcriptional regulator (PF02082; HMM-score: 21.3)MarR; MarR family (PF01047; HMM-score: 19.1)TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 17.4)PLP_aminotran (CL0061) Aminotran_5; Aminotransferase class-V (PF00266; HMM-score: 14.6)HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 14.2)no clan defined UDG; Uracil DNA glycosylase superfamily (PF03167; HMM-score: 13.2)HTH (CL0123) HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004625
- TAT(Tat/SPI): 0.000187
- LIPO(Sec/SPII): 0.000639
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 445958221 NCBI
- RefSeq: WP_000036076 NCBI
- UniProt: see SAUSA300_2245
⊟Protein sequence[edit | edit source]
- MSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.