From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 23-MAY-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_pUSA030017 [new locus tag: SAUSA300_RS14820 ]
  • pan locus tag?:
  • symbol: traH
  • pan gene symbol?:
  • synonym:
  • product: transfer complex protein TraH

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_pUSA030017 [new locus tag: SAUSA300_RS14820 ]
  • symbol: traH
  • product: transfer complex protein TraH
  • replicon: pUSA03
  • strand: +
  • coordinates: 16913..17398
  • length: 486
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAAAAATTATTAACTATAGTTATTTTATTCACTTTGGTTCTGGCTGGTTGTGGCCAA
    AATCAAAGTGAGAAAAATAGTGAAAAACATAATGAAGAAAAAACAGTAGATACTACAGAA
    GAAAGAAACGATATGATAAAAGGTCTAATTGAATATGGTTATGAAAATGATGATTATAAA
    GGTTATAAGCATATGAAAGATATATTATCTGAAAAGTTGCAAAAGCAAGCAGAATTGCAA
    AATCAATCAGCACAAACTAAAGGTGTAAAAAAAGAAACTAAAGACATTAAACTTTATCAA
    GACGTAGATAATGATGATGAATTGATTTATTCTATTAAACTTTCAATTACAAACAAAAAA
    GAGAAAAACTCTGACTACTCAATGAGATATGGGAAAATTGAATTAACGGAAGAAGAAGGT
    AAACAAAAGATAGATAATGTCGAAGAACTAACACAAAGAAATTTAGTAAGTATGAATCAA
    GAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    486

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_pUSA030017 [new locus tag: SAUSA300_RS14820 ]
  • symbol: TraH
  • description: transfer complex protein TraH
  • length: 161
  • theoretical pI: 4.87837
  • theoretical MW: 18763
  • GRAVY: -1.0795

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 17)
    Cell structureCell envelopeOtheruncharacterized lipoprotein (TIGR02722; HMM-score: 15.6)
    extracellular lipase, Pla-1/cef family (TIGR03502; EC 3.1.-.-; HMM-score: 11.3)
  • TheSEED:  
    FIG01110541: hypothetical protein 
  • PFAM:
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 12.6)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 7.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 25 aa
    • Ymax: 0.41
    • Ymax_pos: 25
    • Cmax: 0.203
    • Cmax_pos: 25
    • Smax: 0.935
    • Smax_pos: 18
    • Smean: 0.806
    • D: 0.565
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKLLTIVILFTLVLAGCGQNQSEKNSEKHNEEKTVDTTEERNDMIKGLIEYGYENDDYKGYKHMKDILSEKLQKQAELQNQSAQTKGVKKETKDIKLYQDVDNDDELIYSIKLSITNKKEKNSDYSMRYGKIELTEEEGKQKIDNVEELTQRNLVSMNQE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]