From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00010 [old locus tag: SAP003 ]
  • pan locus tag?:
  • symbol: SA_RS00010
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS00010 [old locus tag: SAP003 ]
  • symbol: SA_RS00010
  • product: hypothetical protein
  • replicon: pN315
  • strand: -
  • coordinates: 2388..3080
  • length: 693
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_003140 (2388..3080) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAATTATAAAATTATTTTCAATAATTTCCTTGTTCCTACTGGTATTTAGCGCGAAT
    TTTTCTAATGCTTACGCAAATGAAGAACAAAAAAGTTCTTTACTAGAAAATCAAAAAGAA
    AAATTGAAAAGCAAAAACATCGAAGTATCACAAATGACCAAGAAAGAAATAAGTTTTCTA
    GAACAATTGCAAAATAAAAATGAAGATATGCAAAAATTCGAAAAGCAAATGAAAAAAGAA
    GGATTTAAAAAAATAAAGCTAGAAGACAAAAATTCTAAATTAAAATATCTAGCTACAGAA
    GCAAATGATAAAAATGCATATGGCTACATAGCTAATAACGCTTATAAAAATGAAAAAACA
    AAAGAAATTGTAGTTTCTGAAACAATATATGATAACTACAACAAAAAAATCACAAAATTC
    ATTGCCGAAAAAAGAAGTATGACTGAAAACAAAGAGGGAAAAATACTTATTAACAAAAAT
    TACGTTGAATATAAGGCTGAAAAAGTTGATAAAAACAGACCGGTAACATATGCAGGATTC
    AAATGGAACGGCAAAGCATTCGCTTGTAGTATGGCTGGACTTTATGCATGTGCTCACTAC
    TGTGGAGTATGGGCAATCGTAAATCCAATAGCCGGCGGTGTATGTGAAGCAGTTTGCGGA
    ACTGCATTTGCAGCTGGATGCTCTGTAGGTTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    693

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS00010 [old locus tag: SAP003 ]
  • symbol: SA_RS00010
  • description: hypothetical protein
  • length: 230
  • theoretical pI: 9.64595
  • theoretical MW: 26072
  • GRAVY: -0.484348

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    putative immunity protein/bacteriocin (TIGR04450; HMM-score: 270.5)
    Cellular processesCellular processesToxin production and resistancehalocin C8-like bacteriocin domain (TIGR04449; HMM-score: 8.8)
    SH3 domain protein (TIGR04211; HMM-score: 4.4)
    integral membrane protein TIGR01906 (TIGR01906; HMM-score: 4.1)
  • TheSEED:
  • PFAM:
    no clan definedDUF2730; Protein of unknown function (DUF2730) (PF10805; HMM-score: 15.6)
    Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 8)
    ATP_synthase (CL0255) ATP-synt_8; ATP synthase protein 8 (PF00895; HMM-score: 7.3)
    no clan definedDUF2206; Predicted membrane protein (DUF2206) (PF09971; HMM-score: 6.7)
    IncA; IncA protein (PF04156; HMM-score: 6.7)
    LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 5.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.724
    • Ymax_pos: 27
    • Cmax: 0.657
    • Cmax_pos: 27
    • Smax: 0.91
    • Smax_pos: 18
    • Smean: 0.82
    • D: 0.761
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446614181 NCBI
  • RefSeq: WP_000691527 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKIIKLFSIISLFLLVFSANFSNAYANEEQKSSLLENQKEKLKSKNIEVSQMTKKEISFLEQLQNKNEDMQKFEKQMKKEGFKKIKLEDKNSKLKYLATEANDKNAYGYIANNAYKNEKTKEIVVSETIYDNYNKKITKFIAEKRSMTENKEGKILINKNYVEYKAEKVDKNRPVTYAGFKWNGKAFACSMAGLYACAHYCGVWAIVNPIAGGVCEAVCGTAFAAGCSVG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS00010 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]