From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS00115 [old locus tag: SAP025 ]
  • pan locus tag?:
  • symbol: SA_RS00115
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS00115 [old locus tag: SAP025 ]
  • symbol: SA_RS00115
  • product: hypothetical protein
  • replicon: pN315
  • strand: +
  • coordinates: 20706..21206
  • length: 501
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_003140 (20706..21206) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGTATGAAATTAAAACTAAAAATGTAGGTGGATGGTTTCATAAAGAGAAGCAAGAAACA
    GGCAATATTGTAATTACTAAAACTTATTTTGAAAAATACACTAAACAAATTAAAGCAGCA
    CAGATGATATTAGATGATTATGAATGGATTAAAAGTGGGAAGTCATTAAAAAAATCAGAG
    AAACAAAATGAAAGTTTAGTTAATGAATTGACTAGTGTCCATATGGAAAATGAAAAGCTG
    GTTGAAGAATTTAATGATTTAGCACAACGTTATAATTATTTGTTGTCAGAGAATGAAAAG
    AAAGATAAAGAACTAAATTATACGCTTAAGTTATTCAATCAAGTTTTTAAAATCATTAAA
    AGTATGATGAAAGAAGAGCGTTATCATACGCTAATAAATCATATTGATAATCATTTAGAC
    AATTCTAAAATACGTGAAGTAATGACGATAGATAACAATGATGAACAGTTCTTTAAGAAG
    AAATATCAAGCACAAGAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS00115 [old locus tag: SAP025 ]
  • symbol: SA_RS00115
  • description: hypothetical protein
  • length: 166
  • theoretical pI: 7.83841
  • theoretical MW: 20044.7
  • GRAVY: -0.998795

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedZapB; Cell division protein ZapB (PF06005; HMM-score: 16.6)
    Spc24; Spc24 subunit of Ndc80 (PF08286; HMM-score: 12.3)
    BCLiA (CL0551) APG6; Autophagy protein Apg6 (PF04111; HMM-score: 11.8)
    no clan definedIncA; IncA protein (PF04156; HMM-score: 11.4)
    Cas_Cmr5; CRISPR-associated protein (Cas_Cmr5) (PF09701; HMM-score: 10.4)
    CREPT; Cell-cycle alteration and expression-elevated protein in tumour (PF16566; HMM-score: 9.4)
    DMPK_coil; DMPK coiled coil domain like (PF08826; HMM-score: 8.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.111
    • Ymax_pos: 40
    • Cmax: 0.144
    • Cmax_pos: 40
    • Smax: 0.142
    • Smax_pos: 39
    • Smean: 0.081
    • D: 0.099
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446195152 NCBI
  • RefSeq: WP_000273007 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MYEIKTKNVGGWFHKEKQETGNIVITKTYFEKYTKQIKAAQMILDDYEWIKSGKSLKKSEKQNESLVNELTSVHMENEKLVEEFNDLAQRYNYLLSENEKKDKELNYTLKLFNQVFKIIKSMMKEERYHTLINHIDNHLDNSKIREVMTIDNNDEQFFKKKYQAQE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS00115 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]