NCBI: 02-MAR-2017
Contents
⊟Summary[edit source | edit]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS03325 [old locus tag: SA0576 ]
- pan locus tag?: SAUPAN002491000
- symbol: SA_RS03325
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit source | edit]
⊟Gene[edit source | edit]
⊟General[edit source | edit]
- type: CDS
- locus tag: SA_RS03325 [old locus tag: SA0576 ]
- symbol: SA_RS03325
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 669034..669237
- length: 204
- essential: unknown
⊟Accession numbers[edit source | edit]
- Location: NC_002745 (669034..669237) NCBI
- MicrobesOnline:
⊟Phenotype[edit source | edit]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit source | edit]
- 1
61
121
181ATGAGTAAAATAAACCACATCACTATTGTATTATCATTTACTAAAGTAGACGCTAACGGC
AAACAAACAGAATTTAAGCGTCGATTCGCTAACATTAACCCTGATGCATCAAACGACCAA
ATTAAAACATTCAGCAAACTTATTGAGCGACTTACTGGAGAAACATATAACAATATCGAA
CTCATCAAATCTTTATCAATTTAA60
120
180
204
⊟Protein[edit source | edit]
⊟General[edit source | edit]
- locus tag: SA_RS03325 [old locus tag: SA0576 ]
- symbol: SA_RS03325
- description: hypothetical protein
- length: 67
- theoretical pI: 10.2144
- theoretical MW: 7656.72
- GRAVY: -0.392537
⊟Function[edit source | edit]
- reaction:
- TIGRFAM:
- TheSEED:
- PFAM: no clan definedDUF1659; Protein of unknown function (DUF1659) (PF07872; HMM-score: 21)Geminin; Geminin (PF07412; HMM-score: 12.3)
⊟Structure, modifications & interactions[edit source | edit]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit source | edit]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- Ymax: 0.251
- Ymax_pos: 21
- Cmax: 0.234
- Cmax_pos: 21
- Smax: 0.383
- Smax_pos: 16
- Smean: 0.282
- D: 0.263
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit source | edit]
⊟Protein sequence[edit source | edit]
- MSKINHITIVLSFTKVDANGKQTEFKRRFANINPDASNDQIKTFSKLIERLTGETYNNIELIKSLSI
⊟Experimental data[edit source | edit]
- experimentally validated: no data available
⊟Expression & Regulation[edit source | edit]
⊟Operon[edit source | edit]
- SA_RS03325 no polycistronic organisation predicted
⊟Regulation[edit source | edit]
- sigma factor:
- regulator:
⊟Transcription pattern[edit source | edit]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit source | edit]
- Aureolib: no data available
⊟Protein stability[edit source | edit]
- half-life: no data available
⊟Biological Material[edit source | edit]
⊟Mutants[edit source | edit]
⊟Expression vector[edit source | edit]
⊟lacZ fusion[edit source | edit]
⊟GFP fusion[edit source | edit]
⊟two-hybrid system[edit source | edit]
⊟FLAG-tag construct[edit source | edit]
⊟Antibody[edit source | edit]
⊟Other Information[edit source | edit]
You are kindly invited to share additional interesting facts.
⊟Literature[edit source | edit]
⊟References[edit source | edit]
⊟Relevant publications[edit source | edit]