From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

⊟Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS03325 [old locus tag: SA0576 ]
  • pan locus tag?: SAUPAN002491000
  • symbol: SA_RS03325
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit source | edit]

⊟Gene[edit source | edit]

⊟General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS03325 [old locus tag: SA0576 ]
  • symbol: SA_RS03325
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 669034..669237
  • length: 204
  • essential: unknown

⊟Accession numbers[edit source | edit]

  • Location: NC_002745 (669034..669237) NCBI
  • MicrobesOnline:

⊟Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAGTAAAATAAACCACATCACTATTGTATTATCATTTACTAAAGTAGACGCTAACGGC
    AAACAAACAGAATTTAAGCGTCGATTCGCTAACATTAACCCTGATGCATCAAACGACCAA
    ATTAAAACATTCAGCAAACTTATTGAGCGACTTACTGGAGAAACATATAACAATATCGAA
    CTCATCAAATCTTTATCAATTTAA
    60
    120
    180
    204

⊟Protein[edit source | edit]

⊟General[edit source | edit]

  • locus tag: SA_RS03325 [old locus tag: SA0576 ]
  • symbol: SA_RS03325
  • description: hypothetical protein
  • length: 67
  • theoretical pI: 10.2144
  • theoretical MW: 7656.72
  • GRAVY: -0.392537

⊟Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedDUF1659; Protein of unknown function (DUF1659) (PF07872; HMM-score: 21)
    and 1 more
    Geminin; Geminin (PF07412; HMM-score: 12.3)

⊟Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

⊟Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.251
    • Ymax_pos: 21
    • Cmax: 0.234
    • Cmax_pos: 21
    • Smax: 0.383
    • Smax_pos: 16
    • Smean: 0.282
    • D: 0.263
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit source | edit]

  • GI: 445958231 NCBI
  • RefSeq: WP_000036086 NCBI
  • UniProt:

⊟Protein sequence[edit source | edit]

  • MSKINHITIVLSFTKVDANGKQTEFKRRFANINPDASNDQIKTFSKLIERLTGETYNNIELIKSLSI

⊟Experimental data[edit source | edit]

  • experimentally validated: no data available

⊟Expression & Regulation[edit source | edit]

⊟Operon[edit source | edit]

  • SA_RS03325 no polycistronic organisation predicted

⊟Regulation[edit source | edit]

  • sigma factor:
  • regulator:

⊟Transcription pattern[edit source | edit]

⊟Protein synthesis (provided by Aureolib)[edit source | edit]

⊟Protein stability[edit source | edit]

  • half-life: no data available

⊟Biological Material[edit source | edit]

⊟Mutants[edit source | edit]

⊟Expression vector[edit source | edit]

⊟lacZ fusion[edit source | edit]

⊟GFP fusion[edit source | edit]

⊟two-hybrid system[edit source | edit]

⊟FLAG-tag construct[edit source | edit]

⊟Antibody[edit source | edit]

⊟Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

⊟Literature[edit source | edit]

⊟References[edit source | edit]

⊟Relevant publications[edit source | edit]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SA_RS03325&oldid=58776"