From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS07140 [old locus tag: SA1259 ]
  • pan locus tag?: SAUPAN003858000
  • symbol: SA_RS07140
  • pan gene symbol?: dfrA
  • synonym:
  • product: dihydrofolate reductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS07140 [old locus tag: SA1259 ]
  • symbol: SA_RS07140
  • product: dihydrofolate reductase
  • replicon: chromosome
  • strand: -
  • coordinates: 1431906..1432385
  • length: 480
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1431906..1432385) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGACTTTATCCATTCTAGTTGCACATGACTTGCAACGAGTAATTGGTTTTGAAAATCAA
    TTACCTTGGCACCTACCAAATGATTTGAAACATGTTAAAAAATTATCAACAGGTCATACT
    TTAGTAATGGGTCGTAAGACATTTGAATCGATTGGTAAACCACTACCGAATCGTCGAAAT
    GTTGTACTTACTTCAGATACAAGTTTCAACGTAGAGGGCGTTGATGTAATTCACTCTATT
    GAAGATATTTACCAACTACCGGGCCATGTTTTCATATTTGGAGGGCAAACATTATTTGAA
    GAAATGATTGATAAAGTGGACGACATGTATATTACTGTTATTGAAGGTAAATTCCGTGGT
    GATACGTTCTTTCCACCTTATACATTTGAAGACTGGGAAGTTGCCTCTTCAGTTGAAGGT
    AAACTAGATGAGAAAAATACAATTCCACATACCTTTCTACATTTAATTCGTAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS07140 [old locus tag: SA1259 ]
  • symbol: SA_RS07140
  • description: dihydrofolate reductase
  • length: 159
  • theoretical pI: 6.30297
  • theoretical MW: 18250.8
  • GRAVY: -0.210063

Function[edit source | edit]

  • reaction:
    EC 1.5.1.3?  ExPASy
    Dihydrofolate reductase5,6,7,8-tetrahydrofolate + NADP+ = 7,8-dihydrofolate + NADPH
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    DHFred (CL0387) DHFR_1; Dihydrofolate reductase (PF00186; HMM-score: 184.4)
    and 1 more
    SUKH (CL0526) SMI1_KNR4; SMI1 / KNR4 family (SUKH-1) (PF09346; HMM-score: 13.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS017105'-nucleotidase, lipoprotein e(P4) family  [1] (data from MRSA252)
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0292050S ribosomal protein L7/L12  [1] (data from MRSA252)
    SA_RS02955elongation factor G  [1] (data from MRSA252)
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA_RS05860cell division protein FtsZ  [1] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [1] (data from MRSA252)
    SA_RS07060dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS07385DNA-binding protein HU  [1] (data from MRSA252)
    SA_RS07955molecular chaperone DnaK  [1] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [1] (data from MRSA252)
    SA_RS08545isocitrate dehydrogenase (NADP(+))  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS08625universal stress protein UspA  [1] (data from MRSA252)
    SA_RS09810non-heme ferritin  [1] (data from MRSA252)
    SA_RS11430Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [1] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [1] (data from MRSA252)
    SA_RS1167050S ribosomal protein L15  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)
    SA_RS1170550S ribosomal protein L5  [1] (data from MRSA252)
    SA_RS1174050S ribosomal protein L22  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1176550S ribosomal protein L3  [1] (data from MRSA252)
    SA_RS13920arginine deiminase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.134
    • Ymax_pos: 17
    • Cmax: 0.115
    • Cmax_pos: 17
    • Smax: 0.212
    • Smax_pos: 13
    • Smean: 0.151
    • D: 0.141
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446097891 NCBI
  • RefSeq: WP_000175746 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS07140 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]