From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS07765 [old locus tag: SA1372 ]
  • pan locus tag?: SAUPAN004121000
  • symbol: SA_RS07765
  • pan gene symbol?: comGC
  • synonym:
  • product: competence protein ComGC

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS07765 [old locus tag: SA1372 ]
  • symbol: SA_RS07765
  • product: competence protein ComGC
  • replicon: chromosome
  • strand: -
  • coordinates: 1578832..1579143
  • length: 312
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1578832..1579143) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTA
    TTAATCATCAGTTTATTATTAATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCAC
    ATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTAATAGTCAAATTGAAGCGTAT
    GCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
    AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCA
    GTTGCAAATTAG
    60
    120
    180
    240
    300
    312

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS07765 [old locus tag: SA1372 ]
  • symbol: SA_RS07765
  • description: competence protein ComGC
  • length: 103
  • theoretical pI: 8.76209
  • theoretical MW: 11315.3
  • GRAVY: 0.283495

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesPathogenesistype II secretion system protein G (TIGR01710; HMM-score: 41.8)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein G (TIGR01710; HMM-score: 41.8)
    Cell structureCell envelopeSurface structuresVerru_Chthon cassette protein D (TIGR02596; HMM-score: 24.9)
    Cellular processesCellular processesPathogenesistype II secretion system protein H (TIGR01708; HMM-score: 20.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein H (TIGR01708; HMM-score: 20.2)
    Cell structureCell envelopeSurface structuresprepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 20.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingprepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 20.1)
    Cell structureCell envelopeSurface structuresVerru_Chthon cassette protein C (TIGR02599; HMM-score: 16.7)
    type II secretion system protein I (TIGR01707; HMM-score: 11.5)
  • TheSEED:
  • PFAM:
    no clan definedN_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 23.8)
    SecD-TM1; SecD export protein N-terminal TM region (PF13721; HMM-score: 15)
    HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 14.2)
    no clan definedSHP; Small hydrophobic protein (PF03579; HMM-score: 13.5)
    Ecm33; GPI-anchored cell wall organization protein (PF12454; HMM-score: 11.4)
    Tad-like (CL0496) TadF; Putative tight adherence pilin protein F (PF16964; HMM-score: 10.2)
    no clan definedDUF5383; Family of unknown function (DUF5383) (PF17355; HMM-score: 7.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.11
    • Cytoplasmic Membrane Score: 0.93
    • Cellwall Score: 8.19
    • Extracellular Score: 0.77
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.287
    • Ymax_pos: 42
    • Cmax: 0.238
    • Cmax_pos: 36
    • Smax: 0.775
    • Smax_pos: 34
    • Smean: 0.302
    • D: 0.293
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446394401 NCBI
  • RefSeq: WP_000472256 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFIKEAQKTCKSGETITISNGEAVAN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS07765 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]