From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS08630 [old locus tag: SA1533 ]
  • pan locus tag?: SAUPAN004363000
  • symbol: SA_RS08630
  • pan gene symbol?: ackA
  • synonym:
  • product: acetate kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS08630 [old locus tag: SA1533 ]
  • symbol: SA_RS08630
  • product: acetate kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 1751880..1753082
  • length: 1203
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1751880..1753082) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    ATGTCAAAATTAATCTTGGCTATCAATGCTGGTAGTTCATCATTAAAATTTCAATTAATT
    AGAATGCCTGAAGAGGAATTAGTAACAAAAGGTTTAATAGAAAGAATCGGATTGAAGGAT
    TCAATTTTTACAATTGAAGTCAACGGGGAAAAAGTTAAAACAGTACAAGATATCAAGGAT
    CACGTTGAGGCAGTTGATATCATGTTGGATGCTTTTAAAGCGCATAATATTATTAATGAT
    ATTAACGATATCGATGGAACAGGTCACCGTGTTGTACATGGTGGTGAAAAATTCCCTGAA
    TCAGTAGCTATTACTGATGAGGTTGAAAAGGAAATTGAAGAATTAAGCGAATTAGCACCG
    CTTCACAACCCAGCTAACTTGATGGGTATTCGTGCTTTCCGTAAGTTATTACCAAATATC
    CCTCATGTGGCAATTTTTGATACAGCATTCCATCAAACAATGCCTGAAAAAGCATATCTA
    TATAGCTTGCCATATCATTATTATAAAGATTATGGCATTCGTAAGTATGGTTTCCATGGT
    ACAAGCCATAAATTTGTATCACAAAGAGCGGCAGAAATGTTAGATAAGCCAATTGAAGAT
    TTACGTATTATTTCATGTCACATTGGTAATGGAGCATCAATTGCAGCTATCGATGGCGGT
    AAATCTATTGATACATCAATGGGCTTCACACCACTTGCTGGTGTAACAATGGGTACTCGT
    TCTGGTAATATTGACCCTGCTTTAATTCCATTTATTATGGAAAAAACAGGTAAAACTGCT
    GAACAAGTATTGGAAATCTTAAACAAAGAATCAGGTTTATTAGGATTATCAGGTACATCT
    AGTGATTTACGTGACTTATCAGAAGAAGCTGAATCAGGTAAAGCACGTTCACAAATGGCT
    TTAGATGTATTTGCTTCTAAAATTCACAAATATATTGGATCATATGCTGCGAGAATGCAT
    GGTGTTGATGTTATCGTATTTACAGCAGGTATCGGTGAAAACTCAGTAGAAATTCGTGCG
    AAAGTTCTTGAAGGCTTAGAATTTATGGGTGTTTACTGGGATCCTAAGAAAAATGAAAAC
    TTACTACGTGGTAAAGAAGGATTTATTAACTATCCTCATTCACCAGTTAAAGTTGTCGTT
    ATTCCAACAGATGAAGAAAGTATGATTGCCCGTGATGTTATGACATTCGGTGGTTTAAAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1203

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS08630 [old locus tag: SA1533 ]
  • symbol: SA_RS08630
  • description: acetate kinase
  • length: 400
  • theoretical pI: 5.88998
  • theoretical MW: 44056.3
  • GRAVY: -0.1305

Function[edit source | edit]

  • reaction:
    EC 2.7.2.1?  ExPASy
    Acetate kinaseATP + acetate = ADP + acetyl phosphate
  • TIGRFAM:
    MetabolismEnergy metabolismFermentationacetate kinase (TIGR00016; EC 2.7.2.1; HMM-score: 561.6)
    MetabolismEnergy metabolismFermentationbutyrate kinase (TIGR02707; EC 2.7.2.7; HMM-score: 71)
  • TheSEED:
  • PFAM:
    Actin_ATPase (CL0108) Acetate_kinase; Acetokinase family (PF00871; HMM-score: 552)
    no clan definedLacAB_rpiB; Ribose/Galactose Isomerase (PF02502; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+, Mn2+
  • effectors:
  • protein partners:
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA_RS05355pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SA_RS05360dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS05365dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS07060dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS0828550S ribosomal protein L27  [1] (data from MRSA252)
    SA_RS08505aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS08545isocitrate dehydrogenase (NADP(+))  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS11430Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [1] (data from MRSA252)
    SA_RS1160550S ribosomal protein L13  [1] (data from MRSA252)
    SA_RS1163050S ribosomal protein L17  [1] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [1] (data from MRSA252)
    SA_RS1167050S ribosomal protein L15  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)
    SA_RS1169050S ribosomal protein L6  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)
    SA_RS1174530S ribosomal protein S19  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1175550S ribosomal protein L23  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.152
    • Ymax_pos: 13
    • Cmax: 0.112
    • Cmax_pos: 22
    • Smax: 0.251
    • Smax_pos: 6
    • Smean: 0.224
    • D: 0.18
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 445962208 NCBI
  • RefSeq: WP_000040063 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSKLILAINAGSSSLKFQLIRMPEEELVTKGLIERIGLKDSIFTIEVNGEKVKTVQDIKDHVEAVDIMLDAFKAHNIINDINDIDGTGHRVVHGGEKFPESVAITDEVEKEIEELSELAPLHNPANLMGIRAFRKLLPNIPHVAIFDTAFHQTMPEKAYLYSLPYHYYKDYGIRKYGFHGTSHKFVSQRAAEMLDKPIEDLRIISCHIGNGASIAAIDGGKSIDTSMGFTPLAGVTMGTRSGNIDPALIPFIMEKTGKTAEQVLEILNKESGLLGLSGTSSDLRDLSEEAESGKARSQMALDVFASKIHKYIGSYAARMHGVDVIVFTAGIGENSVEIRAKVLEGLEFMGVYWDPKKNENLLRGKEGFINYPHSPVKVVVIPTDEESMIARDVMTFGGLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS08630 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]