From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS09050 [old locus tag: SA1607 ]
  • pan locus tag?: SAUPAN004500000
  • symbol: SA_RS09050
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS09050 [old locus tag: SA1607 ]
  • symbol: SA_RS09050
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1842185..1843093
  • length: 909
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (1842185..1843093) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGGATTTATCTTCACCGGTAGTCATTGGACTCATTATTGCAGTAGTCATTGCATTAATC
    TTTTTTGTCCTTTTCTTAGTTGCCTTAGGTAGTAAGAAAAAAGTTAAGCGACAAACAGAA
    GAAAAGTATGAACAACAAGAACAAAACATTAAAAAGTCTCATGAAGAAGCTTTAGAGAAA
    GAGCGTATTCAAAATAAAAAGACAATTACAAAACAACAAGAAGATTATAATCACATGGTT
    AGTACAAAAGATCGTGAGATTGACGCATTAAAATTGTTCTCGAAAAATCATAGTGAATAT
    GTAACGGACATGAGATTAATTGGTATTCGTGAAAGATTAGTTAAAGAAAAACGAATTCGA
    CCAGAAGATATGCACATTATGGCAAATATCTTTTTACCAAAGGATGGCTTTAATAATATT
    GAACGAATTAGTCATTTAGTATTAACAAGAACTGGTCTTTATATTATTGATTCTCAATTG
    TTAAAAGGTCATGTTTATAATGGTATTAGTGGCGGTCAATTTAAAGATTTACCACCAATG
    GAACAAGTATTTGATACATTGGATTTAGATAAATCTAGACCACAAACTATTGTGATGGAT
    CAAAATGATGACAAACGTTCATTATCTTTTGTAAATTATTCAGATCAAATTGAGGCGATT
    AAACAATTGGCTGAAGACTTACAAAAAGAATTAGGTGCCAAATATACGCCAACTTCAATT
    TTATACTTTAATCCTAAAAATGAAGGCGATGTAACGATTTCAAATTATAATCAAAATAGT
    GCTGTCAAAGTGCTTGTCGGTGCTGAACAATTAGACGAGTTCTTTAACAAATTTGTATTC
    CATGGTCGTATTCAATACAACGTGGAAGACTTACAACAAATGATGGATAAAATTGAATCA
    TTCAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    909

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS09050 [old locus tag: SA1607 ]
  • symbol: SA_RS09050
  • description: hypothetical protein
  • length: 302
  • theoretical pI: 6.41787
  • theoretical MW: 35022.9
  • GRAVY: -0.47649

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    cardiolipin synthase (TIGR04265; EC 2.7.8.-; HMM-score: 15.2)
    MetabolismTransport and binding proteinsNucleosides, purines and pyrimidinesnucleoside Transporter (TIGR00939; HMM-score: 11.9)
    Cellular processesCellular processesSporulation and germinationtranscription factor, RsfA family (TIGR02894; HMM-score: 11.6)
    Signal transductionRegulatory functionsDNA interactionstranscription factor, RsfA family (TIGR02894; HMM-score: 11.6)
    MetabolismTransport and binding proteinsUnknown substrateefflux transporter, putative, hydrophobe/amphiphile efflux-3 (HAE3) family (TIGR00921; HMM-score: 11.3)
    Cellular processesCellular processesSporulation and germinationstage III sporulation protein AF (TIGR02896; HMM-score: 9.6)
    MetabolismEnergy metabolismMethanogenesistetrahydromethanopterin S-methyltransferase, subunit B (TIGR04166; EC 2.1.1.86; HMM-score: 8.3)
  • TheSEED:
  • PFAM:
    PDDEXK (CL0236) NERD; Nuclease-related domain (PF08378; HMM-score: 26.8)
    no clan definedDUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 26.6)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 21.4)
    MAP17; Membrane-associated protein 117 kDa, PDZK1-interacting protein 1 (PF15807; HMM-score: 18)
    SecD-TM1; SecD export protein N-terminal TM region (PF13721; HMM-score: 17.1)
    IncA; IncA protein (PF04156; HMM-score: 16.7)
    DUF2681; Protein of unknown function (DUF2681) (PF10883; HMM-score: 16.7)
    Tmemb_9; TMEM9 (PF05434; HMM-score: 16.6)
    DUF3365; Protein of unknown function (DUF3365) (PF11845; HMM-score: 16.3)
    CLN3; CLN3 protein (PF02487; HMM-score: 16.1)
    CPSF100_C; Cleavage and polyadenylation factor 2 C-terminal (PF13299; HMM-score: 15.9)
    Cadherin_C_2; Cadherin cytoplasmic C-terminal (PF16492; HMM-score: 15.9)
    TRAP_alpha; Translocon-associated protein (TRAP), alpha subunit (PF03896; HMM-score: 15.1)
    FAM176; FAM176 family (PF14851; HMM-score: 14.9)
    ArsP_1; Predicted permease (PF03773; HMM-score: 14.7)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 14.5)
    no clan definedEphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 14.3)
    DUF4446; Protein of unknown function (DUF4446) (PF14584; HMM-score: 14.2)
    MMM1; Maintenance of mitochondrial morphology protein 1 (PF10296; HMM-score: 14.1)
    DUF4199; Protein of unknown function (DUF4199) (PF13858; HMM-score: 14.1)
    Oxa1 (CL0376) DUF106; Integral membrane protein DUF106 (PF01956; HMM-score: 14)
    DMT (CL0184) CSG2; Ceramide synthase regulator (PF16965; HMM-score: 13.2)
    no clan definedDUF4330; Domain of unknown function (DUF4330) (PF14221; HMM-score: 13.1)
    DUF2570; Protein of unknown function (DUF2570) (PF10828; HMM-score: 13)
    Baculo_11_kDa; Baculovirus 11 kDa family (PF06143; HMM-score: 12.9)
    DUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 12.3)
    DUF4006; Family of unknown function (DUF4006) (PF13179; HMM-score: 12.3)
    O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 12.2)
    BPD_transp_1 (CL0404) YjgP_YjgQ; Predicted permease YjgP/YjgQ family (PF03739; HMM-score: 12)
    TPR (CL0020) HemY_N; HemY protein N-terminus (PF07219; HMM-score: 11.9)
    no clan definedDUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 11.5)
    Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 11.2)
    Hybrid (CL0105) DUF2254; Predicted membrane protein (DUF2254) (PF10011; HMM-score: 10.4)
    MFS (CL0015) OATP; Organic Anion Transporter Polypeptide (OATP) family (PF03137; HMM-score: 9.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.362
    • Ymax_pos: 34
    • Cmax: 0.285
    • Cmax_pos: 34
    • Smax: 0.667
    • Smax_pos: 28
    • Smean: 0.281
    • D: 0.331
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446288308 NCBI
  • RefSeq: WP_000366163 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MDLSSPVVIGLIIAVVIALIFFVLFLVALGSKKKVKRQTEEKYEQQEQNIKKSHEEALEKERIQNKKTITKQQEDYNHMVSTKDREIDALKLFSKNHSEYVTDMRLIGIRERLVKEKRIRPEDMHIMANIFLPKDGFNNIERISHLVLTRTGLYIIDSQLLKGHVYNGISGGQFKDLPPMEQVFDTLDLDKSRPQTIVMDQNDDKRSLSFVNYSDQIEAIKQLAEDLQKELGAKYTPTSILYFNPKNEGDVTISNYNQNSAVKVLVGAEQLDEFFNKFVFHGRIQYNVEDLQQMMDKIESFN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS09050 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]