From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS11690 [old locus tag: SA2033 ]
  • pan locus tag?: SAUPAN005687000
  • symbol: SA_RS11690
  • pan gene symbol?: rplF
  • synonym:
  • product: 50S ribosomal protein L6

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS11690 [old locus tag: SA2033 ]
  • symbol: SA_RS11690
  • product: 50S ribosomal protein L6
  • replicon: chromosome
  • strand: -
  • coordinates: 2301007..2301543
  • length: 537
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2301007..2301543) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAGTCGTGTTGGTAAGAAAATTATTGACATCCCTAGTGACGTAACAGTAACTTTTGAT
    GGAAATCATGTAACTGTTAAAGGTCCTAAAGGTGAATTATCAAGAACTTTAAATGAAAGA
    ATGACATTCAAACAAGAAGAAAACACAATTGAAGTTGTAAGACCATCTGATTCTAAAGAA
    GATAGAACAAACCATGGTACAACTCGTGCTTTATTAAACAATATGGTACAAGGTGTTTCT
    CAAGGATACGTAAAAGTACTTGAACTTGTTGGTGTAGGTTACCGTGCTCAAATGCAAGGT
    AAAGACTTAATCCTTAACGTTGGTTATTCTCACCCAGTAGAAATTAAAGCTGAAGAAAAC
    ATTACTTTCTCAGTTGAGAAAAACACAGTCGTTAAAGTTGAAGGTATTTCAAAAGAACAA
    GTTGGAGCATTAGCATCTAACATCCGTTCAGTAAGACCTCCAGAGCCTTACAAAGGTAAA
    GGTATTCGTTACCAAGGTGAATACGTTCGCCGTAAAGAAGGTAAAACTGGTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    537

Protein[edit source | edit]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

General[edit source | edit]

  • locus tag: SA_RS11690 [old locus tag: SA2033 ]
  • symbol: SA_RS11690
  • description: 50S ribosomal protein L6
  • length: 178
  • theoretical pI: 10.1171
  • theoretical MW: 19786.4
  • GRAVY: -0.635955

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uL6 (TIGR03654; HMM-score: 247.2)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uL6 (TIGR03653; HMM-score: 79.7)
    Planctomycetes uncharacterized domain TIGR03000 (TIGR03000; HMM-score: 13.3)
  • TheSEED:
  • PFAM:
    no clan definedRibosomal_L6; Ribosomal protein L6 (PF00347; HMM-score: 147.7)
    RAB3GAP2_N; Rab3 GTPase-activating protein regulatory subunit N-terminus (PF14655; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS02145IMP dehydrogenase  [1] (data from MRSA252)
    SA_RS02490YbaB/EbfC family nucleoid-associated protein  [1] (data from MRSA252)
    SA_RS0265050S ribosomal protein L25/general stress protein Ctc  [1] (data from MRSA252)
    SA_RS02695hypoxanthine-guanine phosphoribosyltransferase  [1] (data from MRSA252)
    SA_RS0290550S ribosomal protein L11  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS0294530S ribosomal protein S12  [1] (data from MRSA252)
    SA_RS02955elongation factor G  [1] (data from MRSA252)
    SA_RS03545hypothetical protein  [1] (data from MRSA252)
    SA_RS03665MarR family transcriptional regulator  [1] (data from MRSA252)
    SA_RS04020ribosomal subunit interface protein  [1] (data from MRSA252)
    SA_RS04140aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS04160enolase  [1] (data from MRSA252)
    SA_RS04660NAD-specific glutamate dehydrogenase  [1] (data from MRSA252)
    SA_RS04680glucose-6-phosphate isomerase  [1] (data from MRSA252)
    SA_RS04935hypothetical protein  [1] (data from MRSA252)
    SA_RS05295phosphocarrier protein HPr  [1] (data from MRSA252)
    SA_RS06085beta-ketoacyl-ACP reductase  [1] (data from MRSA252)
    SA_RS06490glutamine synthetase  [1] (data from MRSA252)
    SA_RS07205serine/threonine dehydratase  [1] (data from MRSA252)
    SA_RS0740030S ribosomal protein S1  [1] (data from MRSA252)
    SA_RS07420cytidylate kinase  [1] (data from MRSA252)
    SA_RS07605phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)  [1] (data from MRSA252)
    SA_RS07955molecular chaperone DnaK  [1] (data from MRSA252)
    SA_RS08135hypothetical protein  [1] (data from MRSA252)
    SA_RS08830thiol reductase thioredoxin  [1] (data from MRSA252)
    SA_RS08865dipeptidase PepV  [1] (data from MRSA252)
    SA_RS09445glucosamine-6-phosphate isomerase  [1] (data from MRSA252)
    SA_RS11010uracil phosphoribosyltransferase  [1] (data from MRSA252)
    SA_RS1105050S ribosomal protein L31 type B  [1] (data from MRSA252)
    SA_RS11245glutamine--fructose-6-phosphate aminotransferase  [1] (data from MRSA252)
    SA_RS11430Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    SA_RS1163050S ribosomal protein L17  [1] (data from MRSA252)
    SA_RS1170550S ribosomal protein L5  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1175550S ribosomal protein L23  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.144
    • Ymax_pos: 21
    • Cmax: 0.119
    • Cmax_pos: 29
    • Smax: 0.251
    • Smax_pos: 16
    • Smean: 0.191
    • D: 0.162
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446014120 NCBI
  • RefSeq: WP_000091975 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSRVGKKIIDIPSDVTVTFDGNHVTVKGPKGELSRTLNERMTFKQEENTIEVVRPSDSKEDRTNHGTTRALLNNMVQGVSQGYVKVLELVGVGYRAQMQGKDLILNVGYSHPVEIKAEENITFSVEKNTVVKVEGISKEQVGALASNIRSVRPPEPYKGKGIRYQGEYVRRKEGKTGK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS11690 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]