From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS12990 [old locus tag: SA2263 ]
  • pan locus tag?: SAUPAN006039000
  • symbol: SA_RS12990
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS12990 [old locus tag: SA2263 ]
  • symbol: SA_RS12990
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2541275..2541694
  • length: 420
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2541275..2541694) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAACAAAAAACATGTTTTTGTAATTATTGGTGTCATTTTATGTATATGTATAGTTGCA
    TCAGTCATTTATTTAAAAGTGAAATATGACGAAAAAGAAAAACAAAAAGCAATATACTAT
    AAAGAACAACAGGAGCGTATTACACTCTATCTCCAGCATAATACCAAAGAACCCAATACC
    ATCAAATCTGTGCATTTCACAAGTTTAAAAAGAGGACCCATGGGCGATGCCGTAATTGAA
    GGCTACATCAATGAAAACAAAAAAGATAATTTTACTGCTTATGCTACACCAGAACATAAT
    TATCAGTTTGGTGGTGCTATGATAGAAAGTGAAAGATTAAGTGAGTTACTAAAACCAGCG
    CATCAATTAAAATCACCTGACGAAATCAAAGAAGAATTAGACAAAAAAGAAGGCCACTAG
    60
    120
    180
    240
    300
    360
    420

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS12990 [old locus tag: SA2263 ]
  • symbol: SA_RS12990
  • description: hypothetical protein
  • length: 139
  • theoretical pI: 8.21029
  • theoretical MW: 16097.4
  • GRAVY: -0.604317

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-galactonate transporter (TIGR00893; HMM-score: 15.2)
    Cellular processesCellular processesAdaptations to atypical conditionsphage shock protein B (TIGR02976; HMM-score: 14.3)
    MetabolismEnergy metabolismElectron transportcytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 13.1)
  • TheSEED:
  • PFAM:
    no clan definedDUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 129.6)
    Viral_Beta_CD; Viral Beta C/D like family (PF04530; HMM-score: 15.9)
    DUF1310; Protein of unknown function (DUF1310) (PF07006; HMM-score: 14.6)
    DUF3377; Domain of unknown function (DUF3377) (PF11857; HMM-score: 13.6)
    Sec66; Preprotein translocase subunit Sec66 (PF09802; HMM-score: 13)
    PspB; Phage shock protein B (PF06667; HMM-score: 12.6)
    DUF4500; Domain of unknown function (DUF4500) (PF14937; HMM-score: 12.5)
    O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 12.3)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 11.1)
    no clan definedPMP1_2; ATPase proteolipid family (PF08114; HMM-score: 7.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.386
    • Ymax_pos: 30
    • Cmax: 0.348
    • Cmax_pos: 30
    • Smax: 0.638
    • Smax_pos: 18
    • Smean: 0.431
    • D: 0.403
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446957510 NCBI
  • RefSeq: WP_001034766 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNKKHVFVIIGVILCICIVASVIYLKVKYDEKEKQKAIYYKEQQERITLYLQHNTKEPNTIKSVHFTSLKRGPMGDAVIEGYINENKKDNFTAYATPEHNYQFGGAMIESERLSELLKPAHQLKSPDEIKEELDKKEGH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS12990 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]