From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13240 [old locus tag: SA2309 ]
  • pan locus tag?: SAUPAN006165000
  • symbol: SA_RS13240
  • pan gene symbol?:
  • synonym:
  • product: N-acetyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS13240 [old locus tag: SA2309 ]
  • symbol: SA_RS13240
  • product: N-acetyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 2594670..2594954
  • length: 285
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (2594670..2594954) NCBI
  • BioCyc: G1G21-2689 BioCyc
  • MicrobesOnline: see SA2309

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGTAACCTTGAAATCAAACAAGGCGAGAACAAATTCTATATTGGTGATGATGAAAAT
    AATGCTTTAGCTGAAATCACATACCGTTTTGTGGATAATAATGAAATTAACATTGATCAT
    ACAGGCGTATCTGATGAACTTGGTGGTCAAGGTGTTGGCAAAAAACTAGTTAAAGCAGTT
    GTTGAACACGCTCGAGAAAATCATTTAAAAATTATTGCCTCATGTTCATTTGCCAAACAT
    ATGTTAGAAAAAGAAGATTCATATCAAGATGTATATCTTGGTTAA
    60
    120
    180
    240
    285

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS13240 [old locus tag: SA2309 ]
  • symbol: SA_RS13240
  • description: N-acetyltransferase
  • length: 94
  • theoretical pI: 4.69592
  • theoretical MW: 10556.7
  • GRAVY: -0.551064

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 20.1)
    and 1 more
    methanogenesis imperfect marker protein 11 (TIGR03280; HMM-score: 12.6)
  • TheSEED: see SA2309
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 89.4)
    and 4 more
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 27.2)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 26.8)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 16.3)
    6PGD_C (CL0106) IlvC; Acetohydroxy acid isomeroreductase, catalytic domain (PF01450; HMM-score: 13)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003576
    • TAT(Tat/SPI): 0.000194
    • LIPO(Sec/SPII): 0.000358
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLVKAVVEHARENHLKIIASCSFAKHMLEKEDSYQDVYLG

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]