From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13590 [old locus tag: SA2373 ]
  • pan locus tag?: SAUPAN006266000
  • symbol: SA_RS13590
  • pan gene symbol?:
  • synonym:
  • product: TIGR04197 family type VII secretion effector

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS13590 [old locus tag: SA2373 ]
  • symbol: SA_RS13590
  • product: TIGR04197 family type VII secretion effector
  • replicon: chromosome
  • strand: -
  • coordinates: 2662370..2662648
  • length: 279
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2662370..2662648) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATAATGAGTACAGTTCAAAGTGATATTTTCAAGACTAATAGTGCATCATCATCTATTAAA
    AGTGCCGTTGAAACATGTAATAATGTGTCGAAACCGGATAAAGATGAAAGTACAACAGTA
    AGTGGAAATAATAATGCTCATAGTGTGATAGACGATTTGATTAGTAAGAATCAATCTGTT
    GCTGAAGCAATAAGAAATGCGAGCGATAGTATACAAAAAGTTGGCGAAGAATTTAATCAA
    ACAGACGTAATGATTGGTAATGAAATTGGTAAAAATTAA
    60
    120
    180
    240
    279

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS13590 [old locus tag: SA2373 ]
  • symbol: SA_RS13590
  • description: TIGR04197 family type VII secretion effector
  • length: 92
  • theoretical pI: 4.37085
  • theoretical MW: 9823.65
  • GRAVY: -0.591304

Function[edit source | edit]

  • TIGRFAM:
    type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 68.4)
  • TheSEED:
  • PFAM:
    Prefoldin (CL0200) Prefoldin; Prefoldin subunit (PF02996; HMM-score: 12.8)
    and 1 more
    no clan definedDASH_Duo1; DASH complex subunit Duo1 (PF08651; HMM-score: 10)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.325
    • Ymax_pos: 23
    • Cmax: 0.198
    • Cmax_pos: 64
    • Smax: 0.685
    • Smax_pos: 15
    • Smean: 0.531
    • D: 0.405
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_020977619 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MMSTVQSDIFKTNSASSSIKSAVETCNNVSKPDKDESTTVSGNNNAHSVIDDLISKNQSVAEAIRNASDSIQKVGEEFNQTDVMIGNEIGKN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS13590 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]