From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13705 [old locus tag: SA2395 ]
  • pan locus tag?: SAUPAN006297000
  • symbol: SA_RS13705
  • pan gene symbol?: ldh2
  • synonym:
  • product: L-lactate dehydrogenase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS13705 [old locus tag: SA2395 ]
  • symbol: SA_RS13705
  • product: L-lactate dehydrogenase
  • replicon: chromosome
  • strand: -
  • coordinates: 2682699..2683658
  • length: 960
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2682699..2683658) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAAAACATTTGGTAAAAAGGTTGTATTAATCGGAGATGGATCTGTAGGATCAAGCTAT
    GCCTTTGCAATGGTTACGCAAGGTGTTGCTGATGAATTTGTAATTATTGACATTGCAAAA
    GACAAAGTAAAAGCAGATGTTCAAGATTTAAACCATGGTACAGTCCACAGTCCTTCACCA
    GTTGATGTGAAAGCAGGTGAATACGAAGACTGTAAAGATGCAGATTTAGTTGTTATTACA
    GCTGGTGCACCTCAAAAGCCAGGTGAAACACGTTTACAATTAGTTGAAAAAAATACTAAG
    ATTATGAAGAGCATTGTTAAGAGTGTTATGGATAGCGGCTTTGATGGATATTTCTTAATC
    GCGGCAAACCCTGTTGACATTTTAACAAGATTTGTAAAAGAATATACTGGTTTACCAGCA
    GAGCGTGTTATCGGTTCAGGTACTGTATTGGACAGTGCACGTTTACAATATTTAATTAGC
    CAAGAACTTGGTGTTGCACCTTCAAGTGTTGACGCTAGTATTATTGGTGAGCATGGTGAT
    ACTGAACTTGCAGTTTGGTCACAAGCAAATGTAGCAGGTATTTCAGTATATGACACATTA
    AAAGAACAAACTGGTAGCGAAGCTAAAGCGGAAGAAATTTATGTAAATACACGTGACGCT
    GCTTATGAAATTATCCAAGCTAAAGGGTCAACATACTATGGAATTGCATTAGCATTGATG
    CGCATTTCAAAAGCCATTTTAAATAATGAAAATAATGTCTTAAATGTTTCTATACAATTA
    GATGGTCAATATGGTGGTCACAAAGGCGTTTACCTAGGTGTACCAACATTAGTTAACCAA
    CATGGCGCAGTTAAAATTTATGAAATGCCATTAAGTGCCGAAGAACAAGCGTTGTTCGAT
    AAATCTGTTAAAATATTAGAAGATACATTTGATTCAATTAAATATTTATTAGAAGACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS13705 [old locus tag: SA2395 ]
  • symbol: SA_RS13705
  • description: L-lactate dehydrogenase
  • length: 319
  • theoretical pI: 4.53599
  • theoretical MW: 34431.8
  • GRAVY: -0.0335423

Function[edit source | edit]

  • reaction:
    EC 1.1.1.27?  ExPASy
    L-lactate dehydrogenase(S)-lactate + NAD+ = pyruvate + NADH
  • TIGRFAM:
    MetabolismEnergy metabolismAnaerobicL-lactate dehydrogenase (TIGR01771; EC 1.1.1.27; HMM-score: 419.8)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesisL-lactate dehydrogenase (TIGR01771; EC 1.1.1.27; HMM-score: 419.8)
    MetabolismEnergy metabolismTCA cyclemalate dehydrogenase, NAD-dependent (TIGR01763; EC 1.1.1.37; HMM-score: 209.8)
    MetabolismEnergy metabolismTCA cyclemalate dehydrogenase, NAD-dependent (TIGR01772; EC 1.1.1.37; HMM-score: 71.5)
    malate dehydrogenase (TIGR01759; EC 1.1.1.-; HMM-score: 67.5)
    lactate dehydrogenase (TIGR01756; EC 1.1.1.27; HMM-score: 50.1)
    malate dehydrogenase, NAD-dependent (TIGR01758; EC 1.1.1.37; HMM-score: 46.2)
    malate dehydrogenase, NADP-dependent (TIGR01757; EC 1.1.1.82; HMM-score: 17.7)
    MetabolismAmino acid biosynthesisOtherpyrrolysine biosynthesis protein PylD (TIGR03911; HMM-score: 15.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiazole biosynthesis adenylyltransferase ThiF (TIGR02356; EC 2.7.7.73; HMM-score: 12.4)
    nucleotide sugar dehydrogenase (TIGR03026; HMM-score: 12.2)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) Ldh_1_N; lactate/malate dehydrogenase, NAD binding domain (PF00056; HMM-score: 153.5)
    LDH_C (CL0341) Ldh_1_C; lactate/malate dehydrogenase, alpha/beta C-terminal domain (PF02866; HMM-score: 121.2)
    NADP_Rossmann (CL0063) Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 16.6)
    NAD_binding_7; Putative NAD(P)-binding (PF13241; HMM-score: 15.4)
    UDPG_MGDP_dh_N; UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain (PF03721; HMM-score: 15.2)
    F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 14.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA_RS00335PBP2a family beta-lactam-resistant peptidoglycan transpeptidase MecA  [1] (data from MRSA252)
    SA_RS00690immunoglobulin G-binding protein A  [1] (data from MRSA252)
    SA_RS01085pyruvate decarboxylase  [1] (data from MRSA252)
    SA_RS01275formate acetyltransferase  [1] (data from MRSA252)
    SA_RS0202530S ribosomal protein S18  [1] (data from MRSA252)
    SA_RS0291050S ribosomal protein L1  [1] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [1] (data from MRSA252)
    SA_RS0294530S ribosomal protein S12  [1] (data from MRSA252)
    SA_RS02955elongation factor G  [1] (data from MRSA252)
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS02985UDP-glucose 4-epimerase  [1] (data from MRSA252)
    SA_RS04575NADH dehydrogenase  [1] (data from MRSA252)
    SA_RS05350pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA_RS05355pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SA_RS05360dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS05365dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    SA_RS05860cell division protein FtsZ  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS06240UMP kinase  [1] (data from MRSA252)
    SA_RS07060dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    SA_RS070652-oxoglutarate dehydrogenase E1 component  [1] (data from MRSA252)
    SA_RS07205serine/threonine dehydratase  [1] (data from MRSA252)
    SA_RS07385DNA-binding protein HU  [1] (data from MRSA252)
    SA_RS07955molecular chaperone DnaK  [1] (data from MRSA252)
    SA_RS0846050S ribosomal protein L20  [1] (data from MRSA252)
    SA_RS08505aldehyde dehydrogenase  [1] (data from MRSA252)
    SA_RS08545isocitrate dehydrogenase (NADP(+))  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS08625universal stress protein UspA  [1] (data from MRSA252)
    SA_RS0867530S ribosomal protein S4  [1] (data from MRSA252)
    SA_RS11430Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [1] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [1] (data from MRSA252)
    SA_RS1164530S ribosomal protein S13  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)
    SA_RS1168550S ribosomal protein L18  [1] (data from MRSA252)
    SA_RS1169050S ribosomal protein L6  [1] (data from MRSA252)
    SA_RS1170550S ribosomal protein L5  [1] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [1] (data from MRSA252)
    SA_RS1174050S ribosomal protein L22  [1] (data from MRSA252)
    SA_RS1174530S ribosomal protein S19  [1] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [1] (data from MRSA252)
    SA_RS1175550S ribosomal protein L23  [1] (data from MRSA252)
    SA_RS1176050S ribosomal protein L4  [1] (data from MRSA252)
    SA_RS1176550S ribosomal protein L3  [1] (data from MRSA252)
    SA_RS11925molybdate ABC transporter substrate-binding protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.26
    • Ymax_pos: 24
    • Cmax: 0.277
    • Cmax_pos: 31
    • Smax: 0.43
    • Smax_pos: 1
    • Smean: 0.285
    • D: 0.269
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446769380 NCBI
  • RefSeq: WP_000846636 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKTFGKKVVLIGDGSVGSSYAFAMVTQGVADEFVIIDIAKDKVKADVQDLNHGTVHSPSPVDVKAGEYEDCKDADLVVITAGAPQKPGETRLQLVEKNTKIMKSIVKSVMDSGFDGYFLIAANPVDILTRFVKEYTGLPAERVIGSGTVLDSARLQYLISQELGVAPSSVDASIIGEHGDTELAVWSQANVAGISVYDTLKEQTGSEAKAEEIYVNTRDAAYEIIQAKGSTYYGIALALMRISKAILNNENNVLNVSIQLDGQYGGHKGVYLGVPTLVNQHGAVKIYEMPLSAEEQALFDKSVKILEDTFDSIKYLLED

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS13705 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]