From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS14175 [old locus tag: SA2477 ]
  • pan locus tag?: SAUPAN006441000
  • symbol: SA_RS14175
  • pan gene symbol?:
  • synonym:
  • product: DUF3816 family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS14175 [old locus tag: SA2477 ]
  • symbol: SA_RS14175
  • product: DUF3816 family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2788992..2789546
  • length: 555
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2788992..2789546) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAAAACAAGATATTTCAGTTAAAACTGTTGTTGCGATTGGTATAGGAGCAGCGGTA
    TTTGTGATTTTAGGGCGTTTTGTTGTAATACCAACAGGTTTTCCTAATACGAATATAGAA
    ACATCTTATGCATTTTTAGCATTAATATCTGCAATATTTGGGCCTTTTGCTGGTTTAATG
    ACTGGATTAGTTGGACACGCTATTAAAGATTTCACGACATACGGTAGTGCTTGGTGGAGT
    TGGGTTATTTGTTCAGGAATTATAGGCTGTTTATATGGATGGATTGGCCTAAAATTAAAT
    CTTTCTTCAGGCCTATTTTCTAGGAAATCGATGATTTATTTTAATATCGGTCAAATTATT
    GCGAATATTATTTGCTGGGCACTTATTGCACCAACATTAGATATTTTGATTTATAACGAA
    CCGGCTAACAAGGTTTATACACAAGGTGTTATCTCTGCAGTATTAAATATTATTTCAGTT
    GGTATTATTGGGACAATATTATTAAAAGCATATGCTTCATCTCAAATAAAAAAAGGTAGT
    TTACGTAAAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    555

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS14175 [old locus tag: SA2477 ]
  • symbol: SA_RS14175
  • description: DUF3816 family protein
  • length: 184
  • theoretical pI: 9.9319
  • theoretical MW: 19810.4
  • GRAVY: 0.794022

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsUnknown substrateECF transporter S component, folate family (TIGR04518; HMM-score: 35.7)
  • TheSEED:
  • PFAM:
    Gx_transp (CL0315) ECF-ribofla_trS; ECF-type riboflavin transporter, S component (PF07155; HMM-score: 172.4)
    ECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 28.8)
    no clan definedGlycophorin_A; Glycophorin A (PF01102; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.207
    • Ymax_pos: 30
    • Cmax: 0.141
    • Cmax_pos: 45
    • Smax: 0.536
    • Smax_pos: 25
    • Smean: 0.307
    • D: 0.246
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

  • GI: 446666365 NCBI
  • RefSeq: WP_000743711 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLMTGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGLFSRKSMIYFNIGQIIANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGSLRKE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA_RS14175 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]