From AureoWiki
Jump to: navigation, search

Download gene specific information
Select strain
Preview
locus tagold locus tagnew locus tagorganismpan locus tagpan gene symboltypesymbolsynonymproductcommentrepliconstrandstartendgene lengthessentialGene IDgene RefSeqMicrobesOnlineDNAdescriptionprotein lengththeoretical pItheoretical MWGRAVYECTIGRFAM Meta RoleTIGRFAM Main RoleTIGRFAM Sub RoleTIGRFAM functionTIGRFAMTIGRFAM HMM scoreTheSEEDPFAM AccessionPFAMPFAM descriptionPFAM clan accessionPFAM clanPFAM HMM scoreeffectorinteraction partnersPSORTbLocatePSignalPtransmembrane helicesprotein GIUniProtprotein RefSeqprotein sequenceprotein peptides detectedprotein copies per celloperonregulatorpubmed
SACOL0001SACOL_RS00025S. aureus COLSAUPAN000006000dnaACDSdnaAchromosomal replication initiation proteinchromosome+54419051362unknown3236025YP_184912911483
ATGTCGGAAAAAGAAATTTGGGAAAAAGTGCTTGAAATTGCTCAAGAAAAATTATCAGCTGTAAGTTACTCAACTTTCCTAAAAGATACTGAGCTTTACACGATTAAAGATGGTGAAGCTATCGTATTATCGAGTATTCCTTTTAATGCAAATTGGTTAAATCAACAATATGCTGAAATTATCCAAGCAATCTTATTTGATGTTGTAGGCTATGAAGTTAAACCTCACTTTATTACTACTGAAGAATTAGCAAATTATAGTAATAATGAAACTGCTACTCCAAAAGAAACAACAAAACCTTCTACTGAAACAACTGAGGATAATCATGTGCTTGGTAGAGAGCAATTCAATGCCCATAACACATTTGACACTTTTGTAATCGGACCCGGTAACCGCTTTCCACATGCAGCGAGTTTAGCTGTGGCCGAAGCACCAGCCAAAGCGTACAATCCATTATTTATCTATGGAGGTGTTGGTTTAGGAAAAACCCATTTAATGCATGCCATTGGTCATCATGTTTTAGATAATAATCCAGATGCCAAAGTGATTTACACATCAAGTGAAAAATTCACAAATGAATTTATTAAATCAATTCGTGATAACGAAGGTGAAGCTTTCAGAGAAAGATATCGTAATATCGACGTCTTATTAATCGATGATATTCAGTTCATACAAAACAAGGTACAAACACAAGAAGAATTTTTCTATACTTTTAATGAATTGCATCAGAATAACAAGCAAATAGTTATTTCGAGTGATCGACCACCAAAGGAAATTGCACAATTAGAAGACCGATTACGTTCACGCTTTGAATGGGGGCTAATTGTTGATATTACGCCACCAGATTATGAAACTCGAATGGCAATTTTGCAGAAGAAAATTGAAGAAGAAAAATTAGATATTCCACCAGAAGCTTTAAATTATATAGCAAATCAAATTCAATCTAATATTCGTGAATTAGAAGGTGCATTAACACGTTTACTTGCATATTCACAATTATTAGGAAAACCAATTACAACTGAATTAACTGCTGAAGCTTTAAAAGATATCATTCAAGCACCAAAATCTAAAAAGATTACCATCCAAGATATTCAAAAAATTGTAGGCCAGTACTATAATGTTAGAATTGAAGATTTCAGTGCAAAAAAACGTACAAAGTCAATTGCATATCCGCGTCAAATAGCTATGTACTTGTCTAGAGAGCTTACAGATTTCTCATTACCTAAAATTGGTGAAGAATTTGGTGGGCGTGATCATACGACCGTCATTCATGCTCATGAAAAAATATCTAAAGATTTAAAAGAAGATCCTATTTTTAAACAAGAAGTAGAGAATCTTGAAAAAGAAATAAGAAATGTATAA
chromosomal replication initiation protein4535.1162651965.3-0.488742Genetic information processingDNA metabolismDNA replication, recombination, and repairchromosomal replication initiator protein DnaATIGR00362594.7DNA Metabolism / DNA replication / DNA-replication / Chromosomal replication initiator protein DnaA; Cell Division Subsystem including YidCD / Chromosomal replication initiator protein DnaAPF00308Bac_DnaABacterial dnaA proteinCL0023P-loop_NTPase340.4CytoplasmicIntracellularno predicted signal peptide057651109Q5HJZ5YP_184912
MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
yes 169no polycistronic organisation predicted19997597; 21323324; 24439828; 27344979
SACOL0002SACOL_RS00030S. aureus COLSAUPAN000007000dnaNCDSdnaNDNA polymerase III subunit betachromosome+218333161134unknown3236026YP_184913911484
ATGATGGAATTCACTATTAAAAGAGATTATTTTATTACACAATTAAATGACACATTAAAAGCTATTTCACCAAGAACAACATTACCTATATTAACTGGTATCAAAATCGATGCGAAAGAACATGAAGTTATATTAACTGGTTCAGACTCTGAAATTTCAATAGAAATCACTATTCCTAAAACTGTAGATGGCGAAGATATTGTCAATATTTCAGAAACAGGCTCAGTAGTACTTCCTGGACGATTCTTTGTTGATATTATAAAAAAATTACCTGGTAAAGATGTTAAATTATCTACAAATGAACAATTCCAGACATTAATTACATCAGGTCATTCTGAATTTAATTTAAGTGGCTTAGATCCAGATCAATATCCTTTATTACCTCAAGTTTCTAGAGATGACGCAATTCAATTGTCGGTAAAAGTGCTTAAAAACGTGATTGCACAAACAAATTTTGCAGTGTCCACCTCAGAAACACGCCCAGTACTAACTGGTGTGAACTGGCTTATACAAGAAAATGAATTAATATGCACAGCGACTGACTCACACCGCTTGGCTGTAAGAAAGTTGCAGTTAGAAGATGTTTCTGAAAACAAAAATGTCATCATTCCAGGTAAGGCTTTAGCTGAATTAAATAAAATTATGTCTGACAATGAAGAAGACATTGATATCTTCTTTGCTTCAAACCAAGTTTTATTTAAAGTTGGAAATGTGAACTTTATTTCTCGATTATTAGAAGGACATTATCCTGATACAACACGTTTATTCCCTGAAAACTATGAAATTAAATTAAGTATAGACAATGGGGAGTTTTATCATGCGATTGATCGTGCCTCTTTATTAGCGCGTGAAGGTGGTAATAACGTTATTAAATTAAGTACAGGTGATGACGTTGTTGAATTGTCTTCTACATCACCAGAAATTGGTACTGTAAAAGAAGAAGTTGATGCAAACGATGTTGAAGGTGGTAGCCTGAAAATTTCATTCAACTCTAAATATATGATGGATGCTTTAAAAGCAATCGATAATGATGAGGTTGAAGTTGAATTCTTCGGTACAATGAAACCATTTATTCTAAAACCAAAAGGTGACGACTCGGTAACGCAATTAATTTTACCAATCAGAACTTACTAA
DNA polymerase III subunit beta3774.4028441913.3-0.1615382.7.7.7Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, beta subunitTIGR00663375.1DNA Metabolism / DNA replication / DNA-replication / DNA polymerase III beta subunit (EC 2.7.7.7); Cell Division Subsystem including YidCD / DNA polymerase III beta subunit (EC 2.7.7.7)PF00712DNA_pol3_betaDNA polymerase III beta subunit, N-terminal domainCL0060DNA_clamp184CytoplasmicIntracellularno predicted signal peptide057651110Q5HJZ4YP_184913
MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIRTY
yes 2396no polycistronic organisation predicted19997597; 20108986; 21323324; 22556279; 24439828; 27344979
SACOL0003SACOL_RS00035S. aureus COLSAUPAN000009000-CDSSACOL0003hypothetical proteinchromosome+36973942246unknown3236184YP_184914911485
GTGATTATTTTGGTTCAAGAAGTTGTAGTAGAAGGAGACATTAATTTAGGTCAATTTCTAAAAACAGAAGGGATTATTGAATCTGGTGGTCAAGCAAAATGGTTCTTGCAAGACGTTGAAGTATTAATTAATGGAGTGCGTGAAACACGTCGCGGTAAAAAGTTAGAACATCAAGATCGTATAGATATCCCAGAATTACCTGAAGATGCTGGTTCTTTCTTAATCATTCATCAAGGTGAACAATGA
hypothetical protein814.355789137.35-0.197531Genetic information processingDNA metabolismDNA replication, recombination, and repairS4 domain protein YaaATIGR0298890Hypothetical Coupled to RecF / FIG002958: hypothetical proteinPF13275S4_2S4 domainCL0492S474.4
SACOL0095; SACOL0123; SACOL0204; SACOL0240; SACOL0426; SACOL0452; SACOL0521; SACOL0562; SACOL0570; SACOL0574; SACOL0582; SACOL0583; SACOL0585; SACOL0588; SACOL0591; SACOL0593; SACOL0594; SACOL0634; SACOL0660; SACOL0707; SACOL0721; SACOL0731; SACOL0742; SACOL0746; SACOL0793; SACOL0838; SACOL0839; SACOL0840; SACOL0841; SACOL0842; SACOL0876; SACOL0961; SACOL0966; SACOL1005; SACOL1020; SACOL1072; SACOL1091; SACOL1099; SACOL1155; SACOL1206; SACOL1245; SACOL1262; SACOL1276; SACOL1329; SACOL1368; SACOL1410; SACOL1437; SACOL1513; SACOL1516; SACOL1554; SACOL1587; SACOL1593; SACOL1610; SACOL1622; SACOL1637; SACOL1685; SACOL1741; SACOL1742; SACOL1760; SACOL1762; SACOL1782; SACOL1801; SACOL1831; SACOL1838; SACOL1946; SACOL1960; SACOL2016; SACOL2074; SACOL2091; SACOL2104; SACOL2117; SACOL2128; SACOL2130; SACOL2131; SACOL2145; SACOL2173; SACOL2206; SACOL2213; SACOL2218; SACOL2225; SACOL2238; SACOL2240; SACOL2296; SACOL2415; SACOL2535; SACOL2561; SACOL2569; SACOL2609; SACOL2618; SACOL2622; SACOL2623; SACOL2656; SACOL2657
CytoplasmicIntracellularno predicted signal peptide057651111A0A0H2WXD7YP_184914
MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ
yes 3920MicrobesOnline: SACOL0003 > SACOL0004 > SACOL0005 > SACOL000619997597; 21166474; 21323324; 24439828; 27344979
SACOL0004SACOL_RS00040S. aureus COLSAUPAN000010000recFCDSrecFrecombination protein Fchromosome+393950511113unknown3236185YP_184915911486
ATGAAGTTAAATACACTCCAATTAGAAAATTATCGTAACTATGATGAGGTTACGTTGAAATGTCATCCTGACGTGAATATCCTCATTGGAGAAAATGCACAAGGAAAGACAAATTTACTTGAATCAATTTATACCTTAGCTTTAGCAAAAAGTCATAGAACGAGTAATGATAAGGAACTCATACGTTTTAATGCTGATTATGCTAAAATAGAAGGTGAGCTTAGTTATAGACACGGCACGATGCCATTAACAATGTTTATAACTAAAAAAGGTAAACAAGTCAAAGTGAATCACTTAGAGCAAAGTCGTCTAACTCAATATATTGGACACCTCAATGTGGTTCTATTTGCGCCAGAAGATTTGAATATTGTAAAAGGCTCTCCTCAAATAAGACGACGCTTTATAGATATGGAGTTGGGCCAAATTTCTGCTGTTTACTTAAATGATTTAGCTCAATACCAACGTATTTTAAAGCAAAAGAATAATTACTTAAAGCAGTTACAATTAGGCCAAAAAAAGGACTTAACAATGTTGGAAGTATTAAATCAGCAGTTTGCTGAATATGCAATGAAAGTAACTGATAAACGTGCACATTTTATTCAAGAGCTAGAGTCGTTAGCTAAACCGATTCATGCTGGTATCACAAATGATAAAGAAGCGTTGTCGCTGAATTATTTACCTAGTCTTAAATTTGATTATGCTCAAAATGAAGCGGCACGACTTGAAGAAATTATGTCTATTCTTAGCGATAATATGCAAAGAGAAAAAGAACGAGGCATTAGCTTATTCGGACCACATCGAGATGATATAAGTTTTGATGTGAATGGCATGGATGCTCAAACATATGGTTCTCAAGGACAGCAACGTACAACGGCTTTGTCCATTAAATTAGCTGAAATTGAGTTAATGAATATCGAAGTTGGGGAATATCCCATCTTATTATTAGACGATGTACTCAGTGAATTAGATGATTCGCGTCAAACGCATTTATTAAGTACGATTCAGCATAAAGTACAAACATTTGTCACTACGACATCTGTAGATGGTATTGATCATGAAATCATGAATAACGCTAAATTGTATCGTATTAATCAAGGTGAAATTATAAAGTAA
recombination protein F3706.4468842415.1-0.444054Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA replication and repair protein RecFTIGR00611474.6DNA Metabolism / DNA repair / DNA repair, bacterial RecFOR pathway / DNA recombination and repair protein RecF; Cell Division Subsystem including YidCD / DNA recombination and repair protein RecF; Hypothetical Coupled to RecF / DNA recombination and repair protein RecFPF02463SMC_NRecF/RecN/SMC N terminal domainCL0023P-loop_NTPase60.4
SACOL0204; SACOL0222; SACOL0583; SACOL0584; SACOL0585; SACOL0586; SACOL0593; SACOL0594; SACOL0842; SACOL0944; SACOL1098; SACOL1102; SACOL1103; SACOL1105; SACOL1199; SACOL1257; SACOL1274; SACOL1288; SACOL1448; SACOL1449; SACOL1477; SACOL1702; SACOL1727; SACOL1734; SACOL1741; SACOL1745; SACOL1759; SACOL1769; SACOL1782; SACOL1961; SACOL2072; SACOL2173; SACOL2212; SACOL2214; SACOL2220; SACOL2222; SACOL2224; SACOL2225; SACOL2227; SACOL2230; SACOL2233; SACOL2234; SACOL2236; SACOL2237; SACOL2238; SACOL2239; SACOL2561; SACOL2623
CytoplasmicIntracellularno predicted signal peptide057651112Q5HJZ2YP_184915
MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKLYRINQGEIIK
yes 38MicrobesOnline: SACOL0003 > SACOL0004 > SACOL0005 > SACOL000619997597; 21166474; 21323324; 24439828; 27344979
SACOL0005SACOL_RS00045S. aureus COLSAUPAN000011000gyrBCDSgyrBDNA gyrase, B subunitchromosome+506169951935unknown3236186YP_184916911487
ATGGTGACTGCATTGTCAGATGTAAACAACACGGATAATTATGGTGCTGGGCAAATACAAGTATTAGAAGGTTTAGAAGCAGCACGTAAAAGACCAGGTATGTATATAGGATCGACTTCAGAGAGAGGTTTGCACCATTTAGTGTGGGAAATTGTCGATAATAGTATCGATGAAGCATTAGCTGGTTATGCAAATCAAATTGAAGTTGTTATTGAAAAAGATAACTGGATTAAAGTAACGGATAACGGACGTGGTATCCCAGTTGATATTCAAGAAAAAATGGGACGTCCAGCTGTCGAAGTTATTTTAACTGTTTTACATGCTGGTGGTAAATTTGGCGGTGGCGGATACAAAGTATCTGGTGGTTTACATGGTGTTGGTTCATCAGTTGTAAACGCATTGTCACAAGACTTAGAAGTATATGTACACAGAAATGAGACTATATATCATCAAGCATATAAAAAAGGTGTACCTCAATTTGACTTAAAAGAAGTTGGCACAACTGATAAGACAGGTACTGTCATTCGTTTTAAAGCAGATGGAGAAATCTTCACAGAGACAACTGTATACAACTATGAAACATTACAGCAGCGTATTAGAGAGCTTGCTTTCTTAAACAAAGGAATTCAAATCACATTAAGAGATGAACGTGATGAAGAAAACGTTAGAGAAGACTCCTATCACTATGAGGGCGGTATTAAATCGTACGTTGAGTTATTGAACGAAAATAAAGAACCTATTCATGATGAGCCAATTTATATTCATCAATCTAAAGATGATATTGAAGTAGAAATTGCGATTCAATATAACTCAGGATATGCCACAAATCTTTTAACTTACGCAAATAACATTCATACGTATGAAGGTGGTACGCATGAAGACGGATTCAAACGTGCATTAACGCGTGTCTTAAATAGTTATGGTTTAAGTAGCAAGATTATGAAAGAAGAAAAAGATAGACTTTCTGGTGAAGATACACGTGAAGGTATGACAGCAATTATATCTATCAAACATGGTGATCCTCAATTCGAAGGTCAAACGAAGACAAAATTAGGTAATTCTGAAGTGCGTCAAGTTGTAGATAAATTATTCTCAGAGCACTTTGAACGATTTTTATATGAAAATCCACAAGTCGCACGTACAGTGGTTGAAAAAGGTATTATGGCGGCACGTGCACGTGTTGCTGCGAAAAAAGCGCGTGAAGTAACACGTCGTAAATCAGCGTTAGATGTAGCAAGCCTTCCAGGTAAATTAGCCGATTGCTCTAGTAAAAGTCCTGAAGAATGTGAGATTTTCTTAGTCGAAGGGGACTCTGCCGGGGGGTCTACAAAATCTGGTCGTGACTCTAGAACGCAGGCGATTTTACCATTACGAGGTAAGATATTAAATGTTGAAAAAGCACGATTAGATAGAATTTTGAATAACAATGAAATTCGTCAAATGATCACAGCATTTGGTACAGGAATCGGTGGCGACTTTGATCTAGCGAAAGCAAGATATCACAAAATCGTCATTATGACTGATGCCGATGTGGATGGAGCGCATATTAGAACATTGTTATTAACATTCTTCTATCGATTTATGAGACCGTTAATTGAAGCAGGCTATGTGTATATTGCACAGCCACCGTTGTATAAACTGACACAAGGTAAACAAAAGTATTATGTATACAATGATAGGGAACTTGATAAACTTAAATCTGAATTGAATCCAACACCAAAATGGTCTATTGCACGATACAAAGGTCTTGGAGAAATGAATGCAGATCAATTATGGGAAACAACAATGAACCCTGAGCACCGCGCTCTTTTACAAGTAAAACTTGAAGATGCGATTGAAGCGGACCAAACATTTGAAATGTTAATGGGTGACGTTGTAGAAAACCGTAGACAATTTATAGAAGATAATGCAGTTTATGCAAACTTAGACTTCTAA
DNA gyrase, B subunit6445.6814572511.3-0.4936345.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, B subunitTIGR01059991.1DNA Metabolism / DNA replication / DNA topoisomerases, Type II, ATP-dependent / DNA gyrase subunit B (EC 5.99.1.3); Virulence, Disease and Defense / Resistance to antibiotics and toxic compounds / Resistance to fluoroquinolones / DNA gyrase subunit B (EC 5.99.1.3); Cell Division Subsystem including YidCD / DNA gyrase subunit B (EC 5.99.1.3)PF00204DNA_gyraseBDNA gyrase BCL0329S5211.1
SACOL0006; SACOL0593; SACOL1288; SACOL1745
CytoplasmicIntracellularno predicted signal peptide057651113Q5HJZ1YP_184916
MVTALSDVNNTDNYGAGQIQVLEGLEAARKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
yes 215MicrobesOnline: SACOL0003 > SACOL0004 > SACOL0005 > SACOL000619997597; 21166474; 21323324; 22556279; 24439828; 27344979
SACOL0006SACOL_RS00050S. aureus COLSAUPAN000012000gyrACDSgyrADNA gyrase, A subunitchromosome+703296952664unknown3236187YP_184917911488
ATGGCTGAATTACCTCAATCAAGAATAAATGAACGAAATATTACCAGTGAAATGCGTGAATCATTTTTAGATTATGCGATGAGTGTTATCGTTGCTCGTGCATTGCCAGATGTTCGTGACGGTTTAAAACCAGTACATCGTCGTATACTATATGGATTAAATGAACAAGGTATGACACCGGATAAATCATATAAAAAATCAGCACGTATCGTTGGTGACGTAATGGGTAAATATCACCCTCATGGTGACTCATCTATTTATGAAGCAATGGTACGTATGGCTCAAGATTTCAGTTATCGTTATCCGCTTGTTGATGGCCAAGGTAACTTTGGTTCAATGGATGGAGATGGCGCAGCAGCAATGCGTTATACTGAAGCGCGTATGACTAAAATCACACTTGAACTGTTACGTGATATTAATAAAGATACAATAGATTTTATCGATAACTATGATGGTAATGAAAGAGAGCCGTCAGTCTTACCTGCTCGATTCCCTAACTTATTAGCCAATGGTGCATCAGGTATCGCGGTAGGTATGGCAACGAATATTCCACCACATAACTTAACAGAATTAATCAATGGTGTACTTAGCTTAAGTAAGAACCCTGATATTTCAATTGCTGAGTTAATGGAGGATATTGAAGGTCCTGATTTCCCAACTGCTGGACTTATTTTAGGTAAGAGTGGTATTAGACGTGCATATGAAACAGGTCGTGGTTCAATTCAAATGCGTTCTCGTGCAGTTATTGAAGAACGTGGAGGCGGACGTCAACGTATTGTTGTCACTGAAATTCCTTTCCAAGTGAATAAGGCTCGTATGATTGAAAAAATTGCAGAGCTCGTTCGTGACAAGAAAATTGACGGTATCACTGATTTACGTGATGAAACAAGTTTACGTACTGGTGTGCGTGTCGTTATTGATGTGCGTAAGGATGCAAATGCTAGTGTCATTTTAAATAACTTATACAAACAAACACCTCTTCAAACATCATTTGGTGTGAATATGATTGCACTTGTAAATGGTAGACCGAAGCTTATTAATTTAAAAGAAGCGTTGGTACATTATTTAGAGCATCAAAAGACAGTTGTTAGAAGACGTACGCAATACAACTTACGTAAAGCTAAAGATCGTGCCCACATTTTAGAAGGATTACGTATCGCACTTGACCATATCGATGAAATTATTTCAACGATTCGTGAGTCAGATACAGATAAAGTTGCAATGGAAAGCTTGCAACAACGCTTCAAACTTTCTGAAAAACAAGCTCAAGCTATTTTAGACATGCGTTTAAGACGTCTAACAGGTTTAGAGAGAGACAAAATTGAAGCTGAATATAATGAGTTATTAAATTATATTAGTGAATTAGAAGCAATCTTAGCTGATGAAGAAGTGTTATTACAGTTAGTTAGAGATGAATTGACTGAAATTAGAGATCGTTTCGGTGATGATCGTCGTACAGAAATTCAATTAGGTGGATTTGAAAACTTAGAGGACGAAGACTTAATTCCAGAAGAACAAATAGTAATTACACTAAGCCATAATAACTACATTAAACGTTTGCCGGTATCTACATATCGTGCTCAAAACCGTGGTGGTCGTGGTGTTCAAGGTATGAATACATTGGAAGAAGATTTTGTCAGTCAATTGGTAACTTTAAGTACACATGACCATGTATTGTTCTTTACTAACAAAGGTCGTGTATACAAACTTAAAGGTTACGAAGTGCCTGAGTTATCAAGACAGTCTAAAGGTATTCCTGTAGTGAATGCTATTGAACTTGAAAATGATGAAGTCATTAGTACAATGATTGCTGTTAAAGACCTTGAAAGTGAAGACAACTTCTTAGTGTTTGCAACTAAACGTGGTGTCGTTAAACGTTCAGCATTAAGTAACTTCTCAAGAATAAATAGAAATGGTAAGATTGCGATTTCGTTCAGAGAAGATGATGAGTTAATTGCAGTTCGCTTAACAAGTGGTCAAGAAGATATCTTGATTGGTACATCACATGCATCATTAATTCGATTCCCTGAATCAACATTACGTCCTTTAGGCCGTACAGCAACGGGTGTGAAAGGTATTACACTTCGTGAAGGTGACGAAGTTGTAGGGCTTGATGTAGCTCATGCAAACAGTGTTGATGAAGTATTAGTAGTTACTGAAAATGGTTATGGTAAACGTACGCCAGTTAATGACTATCGCTTATCAAATCGTGGTGGTAAAGGTATTAAAACAGCTACGATTACTGAGCGTAATGGTAATGTTGTATGTATCACTACAGTAACTGGTGAAGAAGATTTAATGATTGTTACTAATGCAGGTGTCATTATTCGACTAGATGTTGCAGATATTTCTCAAAATGGTCGTGCAGCACAAGGTGTTCGCTTAATTCGCTTAGGTGATGATCAATTTGTTTCAACGGTTGCTAAAGTAAAAGAAGATGCAGAAGATGAAACGAATGAAGATGAGCAATCTACTTCAACTGTATCTGAAGATGGTACTGAACAACAACGTGAAGCGGTTGTAAATGATGAAACACCAGGAAATGCAATTCATACTGAAGTGATTGATTCAGAAGAAAATGATGAAGATGGACGTATTGAAGTAAGACAAGATTTCATGGATCGTGTTGAAGAAGATATACAACAATCATCAGATGAAGAATAA
DNA gyrase, A subunit8874.7979899349.3-0.4491545.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, A subunitTIGR010631210.8DNA Metabolism / DNA replication / DNA topoisomerases, Type II, ATP-dependent / DNA gyrase subunit A (EC 5.99.1.3); Virulence, Disease and Defense / Resistance to antibiotics and toxic compounds / Resistance to fluoroquinolones / DNA gyrase subunit A (EC 5.99.1.3); Cell Division Subsystem including YidCD / DNA gyrase subunit A (EC 5.99.1.3)PF00521DNA_topoisoIVDNA gyrase/topoisomerase IV, subunit Ano clan definedno clan defined529.8
SACOL1448
CytoplasmicIntracellularno predicted signal peptide057651114Q5HJZ0YP_184917
MAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELEAILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLGGFENLEDEDLIPEEQIVITLSHNNYIKRLPVSTYRAQNRGGRGVQGMNTLEEDFVSQLVTLSTHDHVLFFTNKGRVYKLKGYEVPELSRQSKGIPVVNAIELENDEVISTMIAVKDLESEDNFLVFATKRGVVKRSALSNFSRINRNGKIAISFREDDELIAVRLTSGQEDILIGTSHASLIRFPESTLRPLGRTATGVKGITLREGDEVVGLDVAHANSVDEVLVVTENGYGKRTPVNDYRLSNRGGKGIKTATITERNGNVVCITTVTGEEDLMIVTNAGVIIRLDVADISQNGRAAQGVRLIRLGDDQFVSTVAKVKEDAEDETNEDEQSTSTVSEDGTEQQREAVVNDETPGNAIHTEVIDSEENDEDGRIEVRQDFMDRVEEDIQQSSDEE
yes 368MicrobesOnline: SACOL0003 > SACOL0004 > SACOL0005 > SACOL000619997597; 20108986; 21166474; 21323324; 22556279; 24439828; 27344979
SACOL0007SACOL_RS00055S. aureus COLSAUPAN000013000nnrDCDSSACOL0007hypothetical proteinchromosome-978210483702unknown3236407YP_184918911489
ATGTTAGCGGCTCGTGCATGTGTATTTAGCGGTAGTGGTTTAATCACTGTAGCTACACATCCAACAAATCATTCAGCATTACATTCTCGTTGCCCAGAAGCGATGGTTATTGATATTAATGATACGAAAATGTTGACGAAAATGATTGAAATGACTGACAGTATACTAATTGGTCCAGGTCTTGGCGTTGATTTCAAAGGAAATAATGCCATTACATTCCTACTACAAAATATACAACCGCATCAAAATTTAATCGTAGACGGCGATGCGATTACAATCTTTAGTAAACTGAAACCGCAATTACCTACATGTCGTGTGATCTTTACACCACACCTCAAAGAATGGGAACGATTAAGTGGTATTCCTATTGAGGAACAGACATATGAGCGTAATCGTGAAGCAGTTGATCGTTTAGGTGCAACTGTTGTACTTAAAAAACATGGTACTGAAATTTTCTTTAAAGATGAAGACTTTAAATTGACAATCGGTAGCCCAGCAATGGCGACTGGTGGTATGGGCGATACACTTGCTGGTATGATTACAAGCTTTGTCGGTCAATTTGATAACTTAAAAGAAGCGGTTATGAGTGCCACATATACACATAGTTTTATTGGCGAAAACCTTGCAAAAGATATGTATGTGGTGCCACCATCAAGACTTATCAATGAAATACCTTACGCAATGAAACAATTAGAAAGTTAG
hypothetical protein2336.153725655.6-0.005150214.2.1.136Unknown functionGeneralYjeF family C-terminal domainTIGR00196137.8ADP-dependent (S)-NAD(P)H-hydrate dehydratase (EC 4.2.1.136)PF01256Carb_kinaseCarbohydrate kinaseCL0118Ribokinase175no significant predictionIntracellularsignal peptide predicted057651115A0A0H2WXB2YP_184918
MLAARACVFSGSGLITVATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQNIQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDRLGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSATYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
yes 19997597; 21323324; 24439828
SACOL0008SACOL_RS00060S. aureus COLSAUPAN000014000hutHCDShutHhistidine ammonia-lyasechromosome+10920124341515unknown3236408YP_184919911490
ATGACTTTATATTTAGATGGTGAAACACTAACAATTGAGGATATTAAATCATTTTTACAACAACAATCAAAGATTGAAATTATTGATGATGCGTTAGAACGTGTCAAAAAAAGTAGAGCGGTAGTTGAACGTATTATTGAAAATGAGGAAACGGTTTACGGTATTACTACAGGTTTTGGGTTATTTAGTGATGTACGTATAGACCCGACGCAATATAATGAATTACAAGTGAATCTGATACGCTCACATGCCTGTGGACTAGGTGAGCCATTTTCAAAAGAAGTAGCATTAGTCATGATGATTTTACGATTGAATACATTATTAAAAGGTCATTCAGGTGCCACTTTAGAATTAGTGAGACAATTACAATTTTTTATAAATGAACGTATTATACCGATAATCCCACAGCAAGGCTCTCTCGGTGCATCAGGAGATTTAGCGCCATTATCACATTTAGCATTAGCATTAATTGGTGAAGGGAAAGTATTGTACAGAGGGGAAGAAAAGGATAGTGACGATGTATTAAGAGAATTAAATAGACAACCTTTGAACCTTCAGGCTAAAGAAGGTTTAGCATTGATTAATGGTACGCAAGCTATGACAGCTCAAGGTGTCATTAGTTATATAGAAGCAGAAGATTTAGGTTACCAATCTGAATGGATTGCTGCATTAACGCATCAGTCTCTTAATGGCATTATAGATGCATATCGACATGATGTGCACGCAGTTCGTAATTTTCAAGAACAGATTAATGTGGCAGCGCGTATGCGTGATTGGTTAGAAGGATCAACATTAACGACGCGACAATCAGAAATACGTGTACAAGATGCATATACGTTGCGTTGTATACCACAAATCCATGGCGCGAGTTTTCAAGTATTCAATTATGTTAAACAGCAATTAGAATTTGAAATGAATGCGGCTAATGATAATCCACTTATATTTGAGGAAGCAAATGAAACGTTTGTTATTTCAGGTGGTAACTTCCATGGACAACCTATTGCTTTTGCATTAGATCATCTTAAATTAGGTGTAAGTGAATTAGCAAACGTATCGGAACGTCGTCTAGAGCGACTAGTAAATCCTCAATTAAATGGTGATTTACCAGCATTTCTTAGTCCAGAGCCAGGATTGCAAAGTGGCGCGATGATTATGCAATATGCTGCTGCAAGTCTCGTTTCTGAAAATAAAACTTTAGCGCATCCAGCGAGTGTTGATTCTATCACTTCATCTGCGAACCAAGAAGATCACGTATCTATGGGAACTACAGCTGCTAGACATGGTTATCAAATTATTGAAAATGCAAGACGTGTGCTGGCAATCGAATGTGTTATTGCATTACAAGCAGCAGAGTTAAAAGGTGTTGAAGGATTATCACCAAAAACACGTCGCAAGTATGATGAGTTTCGAAGTATCGTGCCATCCATTACACATGATCGTCAATTTCATAAAGATATTGAAGCGGTTGCACAGTATTTAAAGCAATCAATTTATCAAACGACTGCATGTCACTAA
histidine ammonia-lyase5045.1467156075.2-0.1857144.3.1.3MetabolismEnergy metabolismAmino acids and amineshistidine ammonia-lyaseTIGR01225665Amino Acids and Derivatives / Histidine Metabolism / Histidine Degradation / Histidine ammonia-lyase (EC 4.3.1.3)PF00221Lyase_aromaticAromatic amino acid lyaseno clan definedno clan defined612.4CytoplasmicIntracellularno predicted signal peptide057651116Q5HJY8YP_184919
MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERIIENEETVYGITTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRLNTLLKGHSGATLELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVLYRGEEKDSDDVLRELNRQPLNLQAKEGLALINGTQAMTAQGVISYIEAEDLGYQSEWIAALTHQSLNGIIDAYRHDVHAVRNFQEQINVAARMRDWLEGSTLTTRQSEIRVQDAYTLRCIPQIHGASFQVFNYVKQQLEFEMNAANDNPLIFEEANETFVISGGNFHGQPIAFALDHLKLGVSELANVSERRLERLVNPQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTLAHPASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKGVEGLSPKTRRKYDEFRSIVPSITHDRQFHKDIEAVAQYLKQSIYQTTACH
yes no polycistronic organisation predictedSACOL1786 *119997597; 20108986; 21323324; 24439828
SACOL0009SACOL_RS00065S. aureus COLSAUPAN000017000serSCDSserSseryl-tRNA synthetasechromosome+12813140991287unknown3236409YP_184920911491
ATGTTAGACATTAGATTATTCAGAAATGAGCCTGACACAGTTAAGAGCAAAATTGAATTACGTGGAGATGATCCAAAAGTTGTAGATGAAATTTTAGAATTGGATGAGCAACGACGTAAATTAATTAGTGCAACAGAAGAAATGAAAGCACGTCGTAATAAAGTAAGCGAAGAAATCGCATTAAAAAAACGTAATAAAGAAAATGCTGATGATGTGATTGCTGAAATGCGCACATTAGGTGACGATATTAAAGAAAAAGATAGTCAATTAAATGAAATTGATAATAAAATGACAGGTATCCTTTGTCGTATTCCAAATTTAATAAGTGATGATGTACCTCAAGGTGAATCTGATGAAGATAACGTTGAAGTTAAAAAGTGGGGTACACCACGTGAGTTTTCATTTGAACCCAAAGCACATTGGGATATTGTAGAAGAATTGAAAATGGCTGATTTTGATCGTGCAGCAAAAGTTTCAGGTGCGCGTTTTGTATATTTAACAAATGAAGGTGCGCAATTAGAGCGTGCTTTAATGAACTATATGATTACAAAACATACAACACAACATGGTTATACAGAAATGATGGTACCACAGCTTGTGAACGCAGATACAATGTATGGTACAGGTCAATTACCTAAATTTGAAGAAGATTTATTTAAAGTAGAAAAAGAAGGATTATATACAATTCCAACTGCTGAAGTACCATTAACGAATTTCTACCGTAATGAAATTATTCAACCAGGTGTACTTCCTGAAAAATTCACTGGTCAATCTGCATGTTTCCGTAGTGAAGCAGGATCAGCAGGTAGAGATACAAGAGGATTAATTCGTTTACATCAATTCGATAAAGTGGAAATGGTACGTTTTGAACAACCTGAAGATTCATGGAATGCTTTAGAAGAAATGACAACAAACGCAGAAGCAATTCTAGAAGAGTTAGGTTTACCATACCGTCGTGTTATTTTATGTACAGGTGATATTGGATTTAGTGCAAGCAAAACATATGATTTAGAAGTTTGGTTACCAAGCTACAATGATTATAAAGAAATTAGTTCATGCTCAAACTGTACGGATTTCCAAGCGCGTCGTGCTAACATCCGCTTCAAGCGTGACAAAGCAGCTAAACCAGAATTAGCACATACATTAAATGGTAGTGGTTTAGCAGTTGGACGTACATTTGCTGCTATTGTTGAAAATTACCAAAATGAAGATGGAACAGTAACAATTCCAGAAGCATTAGTACCATTTATGGGTGGTAAAACACAAATTTCAAAACCAGTTAAATAA
seryl-tRNA synthetase4284.7466548639.7-0.5866826.1.1.11Genetic information processingProtein synthesistRNA aminoacylationserine--tRNA ligaseTIGR00414571.6Amino Acids and Derivatives / Alanine, serine, and glycine / Glycine and Serine Utilization / Seryl-tRNA synthetase (EC 6.1.1.11); Protein Metabolism / Protein biosynthesis / tRNA aminoacylation, Ser / Seryl-tRNA synthetase (EC 6.1.1.11)PF00587tRNA-synt_2btRNA synthetase class II core domain (G, H, P, S and T)CL0040tRNA_synt_II114.8
SACOL0593; SACOL0594; SACOL0838; SACOL1102; SACOL1103; SACOL1104; SACOL1105; SACOL1274; SACOL1449; SACOL1637; SACOL1722; SACOL1745; SACOL1753; SACOL2173; SACOL2236; SACOL2657
CytoplasmicIntracellularno predicted signal peptide057651117Q5HJY7YP_184920
MLDIRLFRNEPDTVKSKIELRGDDPKVVDEILELDEQRRKLISATEEMKARRNKVSEEIALKKRNKENADDVIAEMRTLGDDIKEKDSQLNEIDNKMTGILCRIPNLISDDVPQGESDEDNVEVKKWGTPREFSFEPKAHWDIVEELKMADFDRAAKVSGARFVYLTNEGAQLERALMNYMITKHTTQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVEKEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRDTRGLIRLHQFDKVEMVRFEQPEDSWNALEEMTTNAEAILEELGLPYRRVILCTGDIGFSASKTYDLEVWLPSYNDYKEISSCSNCTDFQARRANIRFKRDKAAKPELAHTLNGSGLAVGRTFAAIVENYQNEDGTVTIPEALVPFMGGKTQISKPVK
yes 760no polycistronic organisation predicted19997597; 21166474; 21323324; 22556279; 24439828; 27344979
SACOL0010SACOL_RS00070S. aureus COLSAUPAN000018000-CDSSACOL0010hypothetical proteinchromosome+1474915444696unknown3236410YP_184921911492
ATGACAACACATTTAAGTTTTAGACAAGGCGTGCAAGAGTGTATCCTAACATTATTGGGTTATGCCGGTGTTGGTATTTCATTTGGTATTGTGGCTTCGTCTCAAAACTTTAGTATTTTAGAAATTGTCTTGTTATGTCTTGTTATATATGCCGGTGCTGCGCAATTTATTATGTGCGCGTTGTTTATAGCAGGTACACCTATATCAGCGATTGTACTAACTGTATTTATCGTAAATTCAAGAATGTTCCTTTTAAGTATGTCGCTTGCACCAAACTTCAAGACATATGGGTTTTGGAACCGTGTTGGATTAGGTTCATTAGTAACTGACGAAACGTTTGGCGTCGCCATTACACCTTATTTAAAAGGAGAAGCTATCAATGATCGTTGGATGCATGGTCTTAACATCACAGCATATTTATTTTGGGCAATTTCATGTGTAGCTGGGGCTTTATTTGGCGAATATATCTCAAATCCGCAAACGCTAGGGTTAGATTTTGCTATCACGGCTATGTTTATCTTTTTGGCCATTGCGCAATTTGAATCAATTACTAAATCGCGATTAAGAATTTACATAGTACTCATTATTGCCGTCATAGTAATGATGTTATCGCTAAGTATGTTTATGCCTTCATATCTAGCAATATTAATTGCAGCCACAATTTCAGCAGCGTTAGGAGTGATGATGGAACAATGA
hypothetical protein2316.49023251631.07186MetabolismTransport and binding proteinsAmino acids, peptides and aminesazaleucine resistance protein AzlCTIGR0034685.5Branched-chain amino acid permeasePF03591AzlCAzlC proteinno clan definedno clan defined126.3Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide757651118A0A0H2WXZ5YP_184921
MTTHLSFRQGVQECILTLLGYAGVGISFGIVASSQNFSILEIVLLCLVIYAGAAQFIMCALFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPYLKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQFESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMEQ
no data available MicrobesOnline: SACOL0010 > SACOL0011
SACOL0011SACOL_RS00075S. aureus COLSAUPAN000019000-CDSSACOL0011hypothetical proteinchromosome+1544115770330unknown3236194YP_184922911493
ATGATAACTCATATGAACATGTTAATACTTATTTTATTGTGTGGTATCGTAACGCTATTAATTCGAATTATACCTTTTATCATGATTTCAAAAGTGCAATTGCCTGATGTCGTGGTTCGATGGCTATCATTTATCCCAATCACACTATTTACGGCACTTGTCATTGACAGCATTATTCAACAGACGCCTCATGGTGAGGGGTATACATTAAACATCCCTTACATTATCGCGCTCATTCCGACGGTTATTTTATCTATAATCACGCGTAGTTTAACTATTACAATTATTAGTGGGATTGTTATCATGGCAGCATTACGATTTTTCTTTTAA
hypothetical protein1099.2996112233.11.47523Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein FTIGR021209.3FIG01107951: hypothetical proteinPF05437AzlDBranched-chain amino acid transport protein (AzlD)no clan definedno clan defined83.4Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide457651119A0A0H2WXM2YP_184922
MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQQTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAALRFFF
no data available MicrobesOnline: SACOL0010 > SACOL0011
SACOL0012SACOL_RS00080S. aureus COLSAUPAN000021000metXCDSSACOL0012homoserine O-acetyltransferasechromosome+1611217101990unknown3236195YP_184923911494
TTGTTTAAGGAGGAAAGAACAATGACAAATTACACAGTAGATACTTTAAATTTAGGGGAATTTATTACAGAATCTGGGGAAGTCATAGATAACTTGCGTTTGAGATATGAGCATGTCGGTTATCATGGACAACCATTAGTTGTAGTTTGTCATGCATTAACTGGCAATCATTTAACATATGGAACAGATGATTATCCGGGTTGGTGGCGAGAAATTATTGATGGGGGATATATACCCATTCACGATTATCAATTTTTAACATTTGATGTTATTGGTAGTCCTTTCGGTTCAAGTTCACCTTTAAACGACCCTCATTTTCCTAAAAAATTAACATTAAGAGATATAGTCAGAGCGAATGAACGAGGTATACAAGCCCTTGGTTATGATAAGATTAATATTTTAATAGGGGGAAGTCTTGGAGGTATGCAAGCAATGGAACTACTCTACAATCAACAGTTTGAAGTAGATAAAGCCATTATCCTTGCTGCAACAAGTCGAACATCATCTTATAGTAGAGCTTTCAATGAAATTGCAAGGCAAGCCATTCATCTTGGTGGTAAGGAAGGTCTAAGTATTGCACGCCAATTAGGTTTTTTGACATATCGATCATCAAAAAGTTATGATGAACGTTTCACGCCGGATGAAGTAGTCGCATACCAACAACATCAAGGTAATAAATTTAAAGAACATTTTGATTTGAATTGTTATCTGACACTGCTAGATGTATTGGATAGTCACAACATTGACCGAGGTCGCACAGACGTAACGCATGTTTTTAAAAATTTAGAAACAAAAGTGTTAACGATGGGGTTCATAGATGATTTGCTATATCCGGATGATCAAGTTCGTGCATTAGGTGAACGTTTTAAATATCATCGTCATTTCTTCGTGCCTGATAATGTTGGGCATGATGGATTCCTACTAAACTTTAGTACCTGGGCACCTAACTTATATCATTTCTTAAATTTAAAGCATTTTAAGCGTAAGTAA
homoserine O-acetyltransferase3296.6153537849.4-0.376292MetabolismAmino acid biosynthesisAspartate familyhomoserine O-acetyltransferaseTIGR01392201.8Amino Acids and Derivatives / Lysine, threonine, methionine, and cysteine / Methionine Biosynthesis / Homoserine O-acetyltransferase (EC 2.3.1.31)PF00561Abhydrolase_1alpha/beta hydrolase foldCL0028AB_hydrolase59.3CytoplasmicIntracellularno predicted signal peptide057651120A0A0H2WYC8YP_184923
MFKEERTMTNYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRK
yes 32no polycistronic organisation predictedSACOL1272 *119997597; 24439828; 27344979
SACOL0013SACOL_RS00085S. aureus COLSAUPAN000023000-CDSSACOL0013hypothetical proteinchromosome+1740718330924unknown3236196YP_184924911495
GTGTTTTCAAAAATACAACCTAAAGCAACAATAATTGCAACGATTGCGTTGGTATTTGTCGCTTTAGCTTTATATCTAGTGCCTGGTTTAGGACTAATATTTGCATTATTTGCAACCATACCAGGTATCGTTTTATGGAATAAATCAATACAATCTTTCGGGATTAGTGCACTTATTACAGTAATTATAACAACTGTTTTAGGTAATACTTTCGTTTTAAGTGCCATCATATTAGTCTTAATTGCAAGTTTAATTATTGGTCAATTGCTCAAAGAAAGAACGTCTAAAGAAAGAATATTATACGTAACAACAGTAGCGATGAGCTTAATTTCATTAATCGCTTTTATGTTACTACAAACATTCGGAAGGATTCCACCATCAGCGAGCATAGTAAAACCTTTCAAGCAAACATTACATGAAGCGATTACGATGAGCGGTGCCGATGCGAATATGACCCAAATATTAGAAGAAGGGTTTAGACAAGCGACCGTTCAATTACCAGGTTTCATCATTATCATTACATTTTTAATCGTCTTAATTAACTTAATCGTTACATTTCCGATTTTACGAAAATTTAAAATCGCTACACCTGTATTTAAGCCACTTTTCGCGTGGCAAATGAGCGGTATTTTATTATGGATATACATTATTGTTATCATATGTTTATTATTTACAGGTCAACCGAGTGTGTTCCAGAGCATTCTTTTAAACTTCCAACTTGTGTTATCATTAGTAATGTATATTCAAGGTTTAAGTGTTATTCATTTCTTTGGTAAAGCGAAAGGTTTGCCGAATGCAGTAACGATTTTACTATTGGTTATCGGTACAATACTGACACCTACGACACATATTGTAGGACTACTTGGTGTTATCGATTTAAGTTTGAATTTGAAGCGAATCATGAAAAATAATTCTAAAAAGTGA
hypothetical protein30710.9471336591.13648CBSS-262719.3.peg.410 / FIG003573: hypothetical proteinPF09991DUF2232Predicted membrane protein (DUF2232)no clan definedno clan defined212.7Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide757651121A0A0H2WXE2YP_184924
MFSKIQPKATIIATIALVFVALALYLVPGLGLIFALFATIPGIVLWNKSIQSFGISALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSKERILYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILEEGFRQATVQLPGFIIIITFLIVLINLIVTFPILRKFKIATPVFKPLFAWQMSGILLWIYIIVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLVIGTILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
yes MicrobesOnline: SACOL0013 > SACOL0014 > SACOL0015 > SACOL001624439828
SACOL0014SACOL_RS00090S. aureus COLSAUPAN000024000-CDSSACOL0014hypothetical proteinchromosome+18345203121968unknown3236197YP_184925911496
ATGAATCGGCAGTCCACTAAGAAAGCTTTACTAATACCATTTGTCATCATGATCATCACAGCAATTGTTTTAATGGGTGTATGGTTTATCTTTAATAGTCTTATAGCACTAATTGCATCTATCGTTCTTGTCGTGATGATTATTGTTAGCATCATTTTATTCAGACAAGCTTTAATGAAAATGGATAGTTATGTAGATGGTTTGAGTGCTCAAATTTCAACAACAAATAATAAAGCAATCAAACATTTACCAATTGGTATCATTGTTTTAGATGAAAATGATCACATCGAATGGGTTAACCAATTTATGACAGATCATATGGAAGCGAATGTCATTTCTGAATCTGTAAATGAAGTATTTCCAAACATTTTAAAGCAATTAGATAGAGTGAAATCCGTTGAAATAGAATATAATCAGTATCATTTCCAAGTACGTTATTCTGAGAATGATCACTGCCTCTATTTCTTTGATATAACTGAACAAGTACAAACAAATGAACTATATGAAAATTCTAAACCAATCATTGCGACATTATTTTTAGATAACTACGATGAGATTACGCAAAATATGAATGATACGCAGCGTTCGGAAATCAACTCAATGGTAACGCGTGTCATTAGTCGATGGGCAACTGAGTATAATATATTTTTCAAAAGATACAGTTCCGATCAATTCGTAGCCTATTTAAATCAAAAAATATTAGCTGACTTAGAAGAATCTAAATTTGATATCTTGAGTCAATTACGTGAAAAAAGTGTTGGTTATCGTGCCCAATTAACATTAAGTATCGGTGTTGGTGAAGGTACTGAAAATTTAATCGACTTAGGTGAATTATCACAATCAGGCCTAGACTTAGCATTAGGACGCGGTGGCGACCAAGTTGCAATTAAAAGTATTAATGGTAATGTGCGTTTCTATGGCGGTAAGACTGACCCGATGGAGAAACGTACTCGTGTAAGAGCACGTGTGATCTCACATGCGTTAAAAGATATCCTTGCAGAGGGTGACAAAGTCATTATCATGGGACATAAACGTCCTGACTTAGATGCAATTGGTGCAGCAATCGGTGTGTCTAGATTTGCAATGATGAATAATTTAGAAGCATACATCGTATTAAATGAGACTGACATTGATCCAACATTACGACGCGTGATGAACGAAATAGATAAAAAGCCAGAGTTAAGAGAGCGATTTATTACATCAGATGATGCTTGGGATATGATGACATCTAAGACAACCGTAGTGATTGTTGATACGCATAAACCGGAACTGGTTTTAGATGAAAATGTCTTAAATAAAGCAAACCGTAAAGTTGTTATCGATCATCATAGACGTGGTGAAAGCTTCATCTCTAATCCATTGTTGATATATATGGAACCATACGCAAGTTCGACAGCTGAATTGGTAACAGAGTTACTGGAATATCAACCAACAGAACAACGTTTAACACGTCTTGAATCAACAGTGATGTATGCAGGTATTATTGTAGATACAAGAAACTTTACATTACGAACAGGATCAAGAACATTCGATGCAGCGAGTTATTTACGTGCACATGGTGCAGATACGATTTTAACGCAACATTTCTTAAAAGATGATGTGGATACTTACATTAATCGATCTGAATTAATTCGAACTGTAAAAGTTGAAGATAATGGCATAGCCATTGCGCATGGTTCAGACGATAAAATTTATCATCCAGTAACAGTTGCACAAGCAGCAGATGAACTGTTAAGTTTAGAAGGTATTGAAGCATCATATGTTGTTGCGAGACGTGAAGATAATCTGATTGGTATATCTGCGCGTTCACTCGGTTCAGTAAATGTCCAGTTAACAATGGAAGCACTTGGTGGCGGTGGACATTTAACCAATGCGGCAACACAACTTAAAGGTGTGACAGTCGAAGAGGCGATAGCACAATTACAACAAGCAATTACAGAACAATTAAGTAGGAGTGAAGATGCATGA
hypothetical protein6554.9008373780.7-0.110229Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR0296617.5CBSS-262719.3.peg.410 / Phosphoesterase, DHH family proteinPF01368DHHDHH familyCL0137HAD79.2CytoplasmicMulti-transmembraneno predicted signal peptide257651122A0A0H2WXB6YP_184925
MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMKMDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTDHMEANVISESVNEVFPNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFLDNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEESKFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSINGNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRFAMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFITSDDAWDMMTSKTTVVIVDTHKPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQRLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINRSELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGISARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
yes MicrobesOnline: SACOL0013 > SACOL0014 > SACOL0015 > SACOL001619997597; 21323324; 24439828
SACOL0015SACOL_RS00095S. aureus COLSAUPAN000025000rplICDSrplI50S ribosomal protein L9chromosome+2030920755447unknown3236535YP_184926911497
ATGAAAGTAATTTTTACACAAGATGTTAAAGGTAAAGGTAAAAAAGGTGAAGTTAAAGAAGTACCAGTAGGTTATGCAAATAACTTCTTATTGAAAAAGAATTATGCTGTAGAAGCAACACCAGGTAACCTTAAACAATTAGAGTTACAGAAAAAACGTGCAAAACAAGAACGCCAACAAGAAATTGAAGATGCTAAAGCATTAAAAGAAACGTTATCAAACATTGAAGTTGAAGTATCAGCAAAAACTGGTGAAGGTGGTAAATTGTTTGGGTCAGTAAGTACAAAACAAATTGCCGAAGCACTAAAAGCACAACATGATATTAAAATTGATAAACGTAAAATGGATTTACCAAATGGAATTCATTCCCTAGGATATACGAATGTACCTGTTAAATTAGATAAAGAAGTTGAAGGTACAATTCGCGTACACACAGTTGAACAATAA
50S ribosomal protein L914810.065416453.8-0.681757Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL9TIGR00158149.7Protein Metabolism / Protein biosynthesis / Ribosome LSU bacterial / LSU ribosomal protein L9p; CBSS-262719.3.peg.410 / LSU ribosomal protein L9pPF03948Ribosomal_L9_CRibosomal protein L9, C-terminal domainno clan definedno clan defined98.6
SACOL0506; SACOL0583; SACOL0585; SACOL0731; SACOL1745; SACOL2238
CytoplasmicIntracellularno predicted signal peptide057651123Q5HJY1YP_184926
MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
yes 1905MicrobesOnline: SACOL0013 > SACOL0014 > SACOL0015 > SACOL001619997597; 20108986; 21166474; 21323324; 22556279; 24439828; 27344979
SACOL0016SACOL_RS00100S. aureus COLSAUPAN000026000dnaCCDSdnaBreplicative DNA helicasechromosome+20787221871401unknown3236536YP_184927911498
ATGGATAGAATGTATGAGCAAAATCAAATGCCGCATAACAATGAAGCTGAACAGTCTGTCTTAGGTTCAATTATTATAGATCCAGAATTGATTAATACTACTCAGGAAGTTTTGCTTCCTGAGTCGTTTTATAGGGGTGCCCATCAACATATTTTCCGTGCAATGATGCACTTAAATGAAGATAATAAAGAAATTGATGTTGTAACATTGATGGATCAATTATCGACGGAAGGTACGTTGAATGAAGCGGGTGGCCCGCAATATCTTGCAGAGTTATCTACAAATGTACCAACGACGCGAAATGTTCAGTATTATACTGATATCGTTTCTAAGCATGCATTAAAACGTAGATTGATTCAAACTGCAGATAGTATTGCCAATGATGGATATAATGATGAACTTGAACTAGATGCGATTTTAAGTGATGCAGAACGTCGAATTTTAGAGCTATCATCTTCTCGTGAAAGCGATGGCTTTAAAGACATTCGAGACGTCTTAGGACAAGTGTATGAAACAGCTGAAGAGCTTGATCAAAATAGTGGTCAAACACCAGGTATACCTACAGGATATCGAGATTTAGACCAAATGACAGCAGGGTTCAACCGAAATGATTTAATTATCCTTGCAGCGCGTCCATCTGTAGGTAAGACTGCGTTCGCACTTAATATTGCACAAAAAGTTGCAACGCATGAAGATATGTATACAGTTGGTATTTTCTCGCTAGAGATGGGTGCTGATCAGTTAGCCACACGTATGATTTGTAGTTCTGGAAATGTTGACTCAAACCGCTTAAGAACGGGTACTATGACTGAGGAAGATTGGAGTCGTTTTACTATAGCGGTAGGTAAATTATCACGTACGAAGATTTTTATTGATGATACACCGGGTATTCGAATTAATGATTTACGTTCTAAATGTCGTCGATTAAAGCAAGAACATGGCTTAGACATGATTGTGATTGACTACTTACAGTTGATTCAAGGTAGTGGTTCACGTGCGTCCGATAACAGACAACAGGAAGTTTCTGAAATCTCTCGTACATTAAAAGCATTAGCCCGTGAATTAGAATGTCCAGTTATCGCATTAAGTCAGTTATCTCGTGGTGTTGAACAACGACAAGATAAACGTCCAATGATGAGTGATATTCGTGAATCTGGTTCGATTGAGCAAGATGCCGATATCGTTGCATTCTTATACCGTGATGATTACTATAACCGTGGCGGCGATGAAGATGATGACGATGATGGTGGTTTCGAGCCACAAACGAATGATGAAAACGGTGAAATTGAAATTATCATTGCTAAGCAACGTAACGGTCCAACAGGCACAGTTAAGTTACATTTTATGAAACAATATAATAAATTTACCGATATCGATTATGCACATGCAGATATGATGTAA
replicative DNA helicase4664.4176752571.3-0.5907733.6.1.-; 3.6.4.12Genetic information processingDNA metabolismDNA replication, recombination, and repairreplicative DNA helicaseTIGR00665585.3CBSS-262719.3.peg.410 / Replicative DNA helicase (DnaB) (EC 3.6.4.12); DNA-replication / Replicative DNA helicase (DnaB) (EC 3.6.4.12)PF03796DnaB_CDnaB-like helicase C terminal domainCL0023P-loop_NTPase383.9
SACOL0731; SACOL1741; SACOL2222
CytoplasmicIntracellularno predicted signal peptide057651124A0A0H2WY00YP_184927
MDRMYEQNQMPHNNEAEQSVLGSIIIDPELINTTQEVLLPESFYRGAHQHIFRAMMHLNEDNKEIDVVTLMDQLSTEGTLNEAGGPQYLAELSTNVPTTRNVQYYTDIVSKHALKRRLIQTADSIANDGYNDELELDAILSDAERRILELSSSRESDGFKDIRDVLGQVYETAEELDQNSGQTPGIPTGYRDLDQMTAGFNRNDLIILAARPSVGKTAFALNIAQKVATHEDMYTVGIFSLEMGADQLATRMICSSGNVDSNRLRTGTMTEEDWSRFTIAVGKLSRTKIFIDDTPGIRINDLRSKCRRLKQEHGLDMIVIDYLQLIQGSGSRASDNRQQEVSEISRTLKALARELECPVIALSQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNRGGDEDDDDDGGFEPQTNDENGEIEIIIAKQRNGPTGTVKLHFMKQYNKFTDIDYAHADMM
yes 217MicrobesOnline: SACOL0013 > SACOL0014 > SACOL0015 > SACOL001619997597; 20108986; 21166474; 21323324; 24439828; 27344979
SACOL0017S. aureus COLSAUPAN000027000-CDSSACOL0017hypothetical proteinchromosome+222632235593unknown3236537YP_184928911499
ATGTTAAGTTTGTGTATTGAAAGTGATAAATTAGTACTGTCAACGCCTCTGTTAAAGGGTTTTAAGGACGTTGAAAACGATTTGTTAAAATGA
hypothetical protein304.636223363.010.293333no significant predictionIntracellularno predicted signal peptide057651125A0A0H2WXM7YP_184928
MLSLCIESDKLVLSTPLLKGFKDVENDLLK
no data available no polycistronic organisation predicted
SACOL0018SACOL_RS00105S. aureus COLSAUPAN000028000purACDSpurAadenylosuccinate synthetasechromosome+22465237481284unknown3236538YP_184929911500
ATGTCATCAATCGTAGTAGTTGGGACACAATGGGGAGACGAAGGAAAAGGAAAAATAACGGATTTCTTGGCAGAACAGTCAGATGTTATCGCGCGTTTTTCAGGTGGTAATAATGCAGGCCATACCATTCAATTTGGCGGAGAAACATATAAATTACATTTAGTACCATCTGGTATCTTTTACAAAGACAAATTAGCGGTAATCGGTAACGGAGTCGTTGTTGATCCAGTTGCACTATTGAAAGAATTAGACGGATTAAATGAACGTGGCATTCCTACAAGTAATTTACGTATATCTAATCGTGCGCAAGTGATTTTACCATATCACTTAGCACAAGATGAATATGAAGAACGTTTACGTGGTGACAATAAGATTGGTACAACTAAAAAAGGTATCGGTCCAGCATATGTAGACAAAGTTCAACGTATCGGTATTCGTATGGCAGATTTACTTGAAAAAGAAACATTCGAAAGATTATTAAAATCAAACATTGAATATAAACAAGCATATTTCAAAGGTATGTTTAACGAAACATGTCCATCATTTGATGATATCTTTGAAGAATATTATGCAGCAGGTCAACGTCTAAAAGAATTTGTAACAGACACATCAAAAATCTTAGACGATGCATTTGTAGCAGATGAAAAGGTACTTTTCGAAGGTGCGCAAGGTGTAATGTTAGATATCGACCATGGTACATATCCATTCGTTACATCAAGTAATCCAATTGCAGGTAACGTTACTGTTGGTACAGGTGTAGGTCCTACATTCGTTTCAAAGGTAATTGGTGTATGTAAAGCTTATACATCACGTGTTGGTGATGGTCCATTCCCTACTGAATTATTCGATGAAGATGGACATCATATTAGAGAGGTTGGTCGTGAATACGGTACAACAACAGGACGTCCACGTCGTGTAGGTTGGTTTGATTCAGTTGTATTACGTCACTCTCGTCGTGTAAGTGGTATTACAGATTTATCTATTAACTCAATCGATGTTTTAACAGGCCTAGACACAGTGAAAATCTGTACAGCTTATGAATTAGACGGTAAAGAAATTACTGAGTACCCAGCAAACTTAGATCAATTAAAACGTTGTAAACCAATCTTTGAAGAGTTACCAGGTTGGACAGAAGACGTAACAAATGTGCGTACTTTAGAAGAATTACCTGAAAATGCACGTAAATATTTAGAGCGTATTTCAGAATTATGTAATGTACAAATTTCTATCTTCTCAGTTGGTCCAGATAGAGAACAAACAAACCTATTAAAAGAATTGTGGTAG
adenylosuccinate synthetase4274.8564547578.4-0.3065576.3.4.4MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisadenylosuccinate synthaseTIGR00184595Miscellaneous / Miscellaneous - no subcategory / EC 6.3.4.- Ligases that form carbon-nitrogen bonds / Adenylosuccinate synthetase (EC 6.3.4.4); Nucleosides and Nucleotides / Purines / Purine conversions / Adenylosuccinate synthetase (EC 6.3.4.4); CBSS-262719.3.peg.410 / Adenylosuccinate synthetase (EC 6.3.4.4)PF00709Adenylsucc_syntAdenylosuccinate synthetaseCL0023P-loop_NTPase588.1
SACOL0015; SACOL0095; SACOL0204; SACOL0437; SACOL0439; SACOL0452; SACOL0457; SACOL0460; SACOL0557; SACOL0564; SACOL0583; SACOL0584; SACOL0585; SACOL0586; SACOL0589; SACOL0591; SACOL0592; SACOL0593; SACOL0594; SACOL0634; SACOL0688; SACOL0815; SACOL0838; SACOL0839; SACOL0840; SACOL0842; SACOL0876; SACOL0914; SACOL0944; SACOL0961; SACOL0966; SACOL0973; SACOL1016; SACOL1020; SACOL1091; SACOL1092; SACOL1102; SACOL1104; SACOL1105; SACOL1155; SACOL1199; SACOL1247; SACOL1254; SACOL1257; SACOL1274; SACOL1276; SACOL1292; SACOL1329; SACOL1368; SACOL1377; SACOL1385; SACOL1448; SACOL1457; SACOL1509; SACOL1513; SACOL1516; SACOL1554; SACOL1610; SACOL1637; SACOL1700; SACOL1702; SACOL1722; SACOL1725; SACOL1727; SACOL1734; SACOL1741; SACOL1745; SACOL1746; SACOL1749; SACOL1769; SACOL1782; SACOL1831; SACOL1902; SACOL1952; SACOL1960; SACOL1961; SACOL2016; SACOL2104; SACOL2112; SACOL2117; SACOL2130; SACOL2145; SACOL2173; SACOL2207; SACOL2212; SACOL2213; SACOL2214; SACOL2215; SACOL2218; SACOL2220; SACOL2222; SACOL2223; SACOL2224; S
CytoplasmicIntracellularno predicted signal peptide057651126Q5HJX8YP_184929
MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTNVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELW
yes 1672no polycistronic organisation predicted19997597; 20108986; 21166474; 21323324; 22556279; 24439828; 27344979
SACOL_tRNA-Glu-1SACOL_RS00110S. aureus COLSAUPAN000029000trnaEtRNASACOL_tRNA-Glu-1tRNA-Gluchromosome+241782425275unknown3236343911501
GGCTCCTTGGTCAAGCGGTTAAGACACCGCCCTTTCACGGCGGTAACACGGGTTCGAGTCCCGTAGGAGTCACCA
tRNA-Glu0no predicted signal peptideno data available MicrobesOnline: SACOL_tRNA-Glu-1 > SACOL_tRNA-Asp-1
SACOL_tRNA-Asp-1SACOL_RS00115S. aureus COLSAUPAN000030000trnaDtRNASACOL_tRNA-Asp-1tRNA-Aspchromosome+242602433273unknown3236345911502
GGTCTCGTAGTGTAGCGGTTAACACGCCTGCCTGTCACGCAGGAGATCGCGGGTTCGATTCCCGTCGAGACCG
tRNA-Asp0no predicted signal peptideno data available MicrobesOnline: SACOL_tRNA-Glu-1 > SACOL_tRNA-Asp-1
SACOL0019SACOL_RS00120S. aureus COLSAUPAN000032000walRCDSyycFDNA-binding response regulator YycFchromosome+2495225653702unknown3236559YP_184930911503
ATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTTAACTTAAAAAAAGAAGGATACGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGACTTAATTTATGAAGAAGAACCAGACATCGTATTACTAGATATCATGTTACCTGGTCGTGATGGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATAATAATGCTTACTGCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTAACGAAACCGTTTAGTACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCATTACTCACAACCAGCACAAGACACTGGAAATGTAACGAATGAAATCACAATTAAAGATATTGTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTAACACATCGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAACATTTATTACAAACAGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTAACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGTCACATCCTGAATATATTGTGACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG
DNA-binding response regulator YycF2334.8121127191.8-0.475536Signal transductionRegulatory functions; Signal transductionDNA interactions; Two-component systemsphosphate regulon transcriptional regulatory protein PhoBTIGR02154235.8Iron acquisition and metabolism / Iron acquisition and metabolism - no subcategory / Heme, hemin uptake and utilization systems in GramPositives / Two-component response regulator SA14-24PF00072Response_regResponse regulator receiver domainCL0304CheY103.1
SACOL0506; SACOL0557; SACOL1104; SACOL1274; SACOL1516; SACOL2104; SACOL2233; SACOL2623
CytoplasmicIntracellularno predicted signal peptide057651127Q5HJX7YP_184930
MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
yes 779MicrobesOnline: SACOL0019 > SACOL0020 > SACOL0021 > SACOL0022SACOL2035 *114762013; 17827301; 19997597; 20108986; 21166474; 21323324; 22556279; 22825451; 24439828; 27344979
SACOL0020SACOL_RS00125S. aureus COLSAUPAN000033000walKCDSyycGsensory box histidine kinase YycGchromosome+25666274921827unknown3236560YP_184931911504
ATGAAGTGGCTAAAACAACTACAATCCCTTCATACTAAACTTGTAATTGTTTATGTATTACTGATTATCATTGGTATGCAAATTATCGGGTTATATTTTACAAATAACCTTGAAAAAGAGCTGCTTGATAATTTTAAGAAGAATATTACGCAGTACGCGAAACAATTAGAAATTAGTATTGAAAAAGTATATGACGAAAAGGGCTCCGTAAATGCACAAAAAGATATTCAAAATTTATTAAGTGAGTATGCCAACCGTCAAGAAATTGGAGAAATTCGTTTTATAGATAAAGACCAAATTATTATTGCGACGACGAAGCAGTCTAACCGTAGTCTAATCAATCAAAAAGCGAATGATAGTTCTGTCCAAAAAGCACTATCACTAGGACAATCAAACGATCATTTAATTTTAAAAGATTATGGCGGTGGTAAGGACCGTGTCTGGGTATATAATATCCCAGTTAAAGTCGATAAAAAGGTAATTGGTAATATTTATATCGAATCAAAAATTAATGACGTTTATAACCAATTAAATAATATAAATCAAATATTCATTGTTGGTACAGCTATTTCATTATTAATCACAGTCATCCTAGGATTCTTTATAGCGCGAACGATTACCAAACCAATCACCGATATGCGTAACCAGACGGTCGAAATGTCCAGAGGTAACTATACGCAACGTGTGAAGATTTATGGTAATGATGAAATTGGCGAATTAGCTTTAGCATTTAATAACTTGTCTAAACGTGTACAAGAAGCGCAGGCTAATACTGAAAGTGAGAAACGTAGACTGGACTCAGTTATCACCCATATGAGTGATGGTATTATTGCAACAGACCGCCGTGGACGTATTCGTATCGTCAATGATATGGCACTCAAGATGCTTGGTATGGCGAAAGAAGACATCATCGGATATTACATGTTAAGTGTATTAAGTCTTGAAGATGAATTTAAACTGGAAGAAATTCAAGAGAATAATGATAGTTTCTTATTAGATTTAAATGAAGAAGAAGGTCTAATCGCACGTGTTAACTTTAGTACGATTGTGCAGGAAACAGGATTTGTAACTGGTTATATCGCTGTGTTACATGACGTAACTGAACAACAACAAGTTGAACGTGAGCGTCGTGAATTTGTTGCCAATGTATCACATGAGTTACGTACACCTTTAACTTCTATGAATAGTTACATTGAAGCACTTGAAGAAGGTGCATGGAAAGATGAGGAACTTGCGCCACAATTTTTATCTGTTACCCGTGAAGAAACAGAACGAATGATTCGACTGGTCAATGACTTGCTACAGTTATCTAAAATGGATAATGAGTCTGATCAAATCAACAAAGAAATTATCGACTTTAACATGTTCATTAATAAAATTATTAATCGACATGAAATGTCTGCGAAAGATACAACATTTATTCGAGATATTCCGAAAAAGACGATTTTCACAGAATTTGATCCTGATAAAATGACGCAAGTATTTGATAATGTCATTACAAATGCGATGAAATATTCTAGAGGCGATAAACGTGTCGAGTTCCACGTGAAACAAAATCCACTTTATAATCGAATGACGATTCGTATTAAAGATAATGGCATTGGTATTCCTATCAATAAAGTCGATAAGATATTCGACCGATTCTATCGTGTAGATAAGGCACGTACGCGTAAAATGGGTGGTACTGGATTAGGACTAGCCATTTCGAAAGAGATTGTGGAAGCGCACAATGGTCGTATTTGGGCAAACAGTGTAGAAGGTCAAGGTACATCTATCTTTATCACACTTCCATGTGAAGTCATTGAAGACGGTGATTGGGATGAATAA
sensory box histidine kinase YycG6085.3988369923.5-0.3537832.7.13.3Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR02966248Iron acquisition and metabolism / Iron acquisition and metabolism - no subcategory / Heme, hemin uptake and utilization systems in GramPositives / Two-component sensor kinase SA14-24PF02518HATPase_cHistidine kinase-, DNA gyrase B-, and HSP90-like ATPaseCL0025His_Kinase_A92.8
SACOL0019; SACOL1274; SACOL2222
Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide257651128Q5HJX6YP_184931
MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNINQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEVIEDGDWDE
yes MicrobesOnline: SACOL0019 > SACOL0020 > SACOL0021 > SACOL0022SACOL2035 *114762013; 17827301; 19997597; 21166474; 22825451; 24439828
SACOL0021SACOL_RS00130S. aureus COLSAUPAN000034000walHCDSyycHhypothetical proteinchromosome+27485288191335unknown3236561YP_184932911505
ATGAATAATAAGGAGCATATTAAATCTGTCATTTTAGCACTACTCGTCTTGATGAGTGTCGTATTGACATATATGGTATGGAACTTTTCTCCTGATATTGCAAATGTCGACAATACAGATAGTAAGAAGAGTGAAACGAAACCTTTAACGACACCTATGACAGCCAAAATGGATACAACTATTACGCCATTTCAGATTATTCATTCGAAAAATGATCATCCAGAAGGAACGATTGCGACGGTATCTAATGTGAATAAACTGACGAAACCTTTGAAAAATAAAGAAGTGAAGTCCGTGGAACATGTTCGTCGTGATCATAACTTGATGATTCCTGATTTGAACAGTGATTTTATATTATTCGATTTTACGTATGATTTACCGTTATCAACATATCTTGGTCAAGTACTGAACATGAATGCGAAAGTACCAAATCATTTCAATTTCAATCGTTTGGTCATAGATCATGATGCTGATGATAATATCGTGCTTTATGCTATAAGCAAAGATCGCCACGATTACGTAAAATTAACAACTACAACGAAAAATGATCATTTTTTAGATGCATTAGCAGCAGTGAAAAAAGATATGCAACCATACACAGATATCATCACAAACAAAGATACAATTGATCGTACGACGCATGTTTTTGCACCAAGTAAACCTGAAAAGTTAAAAACATATCGCATGGTATTTAACACGATTAGTGTTGAGAAAATGAATGCTATACTATTTGACGATTCAACCATCGTTCGTAGTTCAAAGAGTGGTGTTACAACCTACAACAATAATACAGGTGTCGCAAACTATAACGATAAAAATGAAAAATATCATTATAAAAACCTGTCCGAAGATGAAGCGAGTTCCAGCAAAATGGAAGAAACGATTCCAGGAACCTTTGATTTTATTAATGGTCATGGTGGTTTCTTAAACGAAGACTTTAGATTGTTTAGTACGAATAATCAGTCAGGCGAGTTAACATATCAACGTTTCCTTAATGGTTATCCAACGTTTAATAAAGAAGGTTCTAATCAAATTCAAGTCACTTGGGGTGAAAAAGGCGTCTTTGACTATCGTCGTTCGTTATTACGCACCGACGTTGTTTTAAATAGTGAGGATAATAAATCGTTGCCGAAATTAGAGTCTGTACGTTCAAGCTTAGCGAACAATAGTGATATTAATTTTGAAAAAGTAACAAACATCGCTATCGGTTACGAAATGCAGGATAATTCAGATCATAATCACATTGAAGTGCAGATTAACAGTGAACTCGTACCGCGTTGGTATGTAGAATATGATGGCGAATGGTATGTTTATAACGATGGGAGGCTTGAATAA
hypothetical protein4445.7407150924.7-0.58536Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein CTIGR0171316.7Cofactors, Vitamins, Prosthetic Groups, Pigments / Tetrapyrroles / CPO analysis / FIG011501: YycH proteinPF07435YycHYycH proteinCL0285YycI_YycH451.5no significant predictionN-terminally anchored (No CS)no predicted signal peptide157651129A0A0H2WYD3YP_184932
MNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTTPMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIPDLNSDFILFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRHDYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVFNTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKMEETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGEKGVFDYRRSLLRTDVVLNSEDNKSLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSDHNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
yes MicrobesOnline: SACOL0019 > SACOL0020 > SACOL0021 > SACOL002219997597; 20108986; 21323324; 24439828; 26999783
SACOL0022SACOL_RS00135S. aureus COLSAUPAN000035000walICDSyycIhypothetical proteinchromosome+2882029608789unknown3236735YP_184933911506
ATGAACTGGAAACTGACAAAGACACTTTTCATTTTCGTGTTTATTCTTGTCAACATCGTGTTAGTATCGATTTATGTTAATAAAGTCAATCGCTCACACATTAATGAAGTCGAGAGTAACAATGAAGTTAATTTTCAGCAAGAAGAAATTAAAGTACCGACTAGTATATTGAATAAATCAGTTAAAGGTATAAAATTAGAGCAAATTACAGGGCGATCAAAAGACTTTAGTTCTAAAGCTAAAGGCGATTCGGATTTGACCACATCAGATGGTGGAAAATTATTGAATGCGAACATTAGTCAATCGGTAAAGGTCAGTGACAATAACTTAAAAGATTTGAAAGATTATGTTAACAAGCGCGTATTTAAAGGTGCTGAATATCAATTAAGCGAGATTAGTTCAGATTCTGTAAAATATGAACAAACGTATGATGATTTTCCGATTTTAAATAACAGTAAAGCGATGTTGAACTTTAATATAGAAGATAACAAAGCGACTAGTTATAAACAATCAATGATGGATGACATTAAGCCCACAGATGGTGCAGATAAGAAGCATCAAGTGATTGGTGTGAGAAAAGCAATCGAGGCATTATATTATAATCGTTACTTGAAAAAAGGTGATGAAGTCATTAATGCTAGACTCGGTTACTACTCAGTCGTGAATGAAACGAATGTTCAATTGTTACAACCAAACTGGGAAATTAAAGTGAAGCATGACGGTAAGGATAAAACGAATACTTACTATGTCGAAGCGACAAATAATAACCCTAAAATTATTAATCATTAA
hypothetical protein2629.3692429931.6-0.621756Cofactors, Vitamins, Prosthetic Groups, Pigments / Tetrapyrroles / CPO analysis / hypothetical protein SA_21PF09648YycIYycH proteinCL0285YycI_YycH175no significant predictionN-terminally anchored (No CS)no predicted signal peptide157651130A0A0H2WXE7YP_184933
MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPTSILNKSVKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKRVFKGAEYQLSEISSDSVKYEQTYDDFPILNNSKAMLNFNIEDNKATSYKQSMMDDIKPTDGADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHDGKDKTNTYYVEATNNNPKIINH
yes MicrobesOnline: SACOL0019 > SACOL0020 > SACOL0021 > SACOL002219997597; 24439828; 26999783
SACOL0023SACOL_RS00140S. aureus COLSAUPAN000036000walJCDSyycJmetallo-beta-lactamase YycJchromosome+2999830798801unknown3236736YP_184934911507
ATGAGCCGCTTGATACGCATGAGTGTATTAGCAAGTGGTAGTACAGGTAACGCCACTTTTGTAGAAAATGAAAAAGGTAGTCTATTAGTTGATGTTGGTTTGACTGGAAAGAAAATGGAAGAATTGTTTAGTCAAATTGACCGTAATATTCAAGATTTAAATGGTATTTTAGTAACCCATGAACATATTGATCATATTAAAGGATTAGGTGTTTTGGCGCGTAAATATCAATTGCCAATTTATGCGAATGAAAAGACTTGGCAGGCAATTGAAAAGAAAGATAGTCGCATCCCTATGGATCAGAAATTCATTTTTAATCCTTATGAAACAAAATCTATTGCAGGTTTCGATGTTGAATCGTTTAACGTGTCACATGATGCAATAGATCCGCAATTTTATATTTTCCATAATAACTATAAGAAGTTTACGATTTTAACGGATACGGGTTACGTGTCTGATCGTATGAAAGGTATGATACGTGGCAGCGATGCGTTTATTTTTGAGAGTAATCATGACGTCGATATGTTGAGAATGTGTCGTTATCCATGGAAGACGAAACAACGTATTTTAGGCGATATGGGTCATGTATCTAATGAGGATGCGGCTCATGCAATGACAGACGTGATTACAGGTAACACGAAACGTATTTACCTATCGCATTTATCACAAGACAATAACATGAAAGATTTGGCGCGTATGAGTGTTGGCCAAGTATTGAACGAACACGATATTGATACGGAAAAAGAAGTATTGCTATGTGATACGGATAAAGCTATTCCAACGCCAATATATACAATATAA
metallo-beta-lactamase YycJ2666.3490430327.4-0.397368Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341333.5Heme, hemin uptake and utilization systems in GramPositives / Zn-dependent hydrolase YycJ/WalJ, required for cell wall metabolism and coordination of cell division with DNA replicationPF00753Lactamase_BMetallo-beta-lactamase superfamilyCL0381Metallo-HOrase81.1CytoplasmicIntracellularno predicted signal peptide057651131A0A0H2WXC0YP_184934
MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTHEHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVESFNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCRYPWKTKQRILGDMGHVSNEDAAHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLNEHDIDTEKEVLLCDTDKAIPTPIYTI
yes no polycistronic organisation predicted24439828; 26999783
SACOL0024SACOL_RS00145S. aureus COLSAUPAN000037000adsACDSSACOL00245'-nucleotidasechromosome+31026333442319unknown3236737YP_184935911508
ATGAAAGCTTTATTACTTAAAACAAGTGTATGGCTCGTTTTGCTTTTTAGTGTAATGGGATTATGGCAAGTCTCGAACGCGGCTGAGCAGCATACACCAATGAAAGCACATGCAGTAACAACGATAGACAAAGCAACAACAGATAAGCAACAAGTACCGCCAACAAAGGAAGCGGCTCATCATTCTGGCAAAGAAGCGGCAACCAACGTATCAGCATCAGCGCAGGGAACAGCTGATGATACAAACAGCAAAGTAACATCCAACGCACCATCTAACAAACCATCTACAGTAGTTTCAACAAAAGTAAACGAAACACGCGACGTAGATACACAACAAGCCTCAACACAAAAACCAACTCACACAGCAACGTTCAAATTATCAAATGCTAAAACAGCATCACTTTCACCACGAATGTTTGCTGCTAATGCACCACAAACAACAACACATAAAATATTACATACAAATGATATCCATGGCCGACTAGCCGAAGAAAAAGGGCGTGTCATCGGTATGGCTAAATTAAAAACAGTAAAAGAACAAGAAAAGCCTGATTTAATGTTAGACGCAGGAGACGCCTTCCAAGGTTTACCACTTTCAAACCAGTCTAAAGGTGAAGAAATGGCTAAAGCAATGAATGCAGTAGGTTATGATGCTATGGCAGTCGGTAACCATGAATTTGACTTTGGATACGATCAGTTGAAAAAGTTAGAGGGTATGTTAGACTTCCCGATGCTAAGTACTAACGTTTATAAAGATGGAAAACGCGCGTTTAAGCCTTCAACGATTGTAACAAAAAATGGTATTCGTTATGGAATTATTGGTGTAACGACACCAGAAACAAAGACGAAAACAAGACCTGAAGGCATTAAAGGCGTTGAATTTAGAGATCCATTACAAAGTGTGACAGCGGAAATGATGCGTATTTATAAAGACGTAGATACATTTGTTGTTATATCACATTTAGGAATTGATCCTTCAACACAAGAAACATGGCGTGGTGATTACTTAGTGAAACAATTAAGTCAAAATCCACAATTGAAGAAACGTATTACAGTTATTGATGGTCATTCACATACAGTACTTCAAAATGGTCAAATTTATAACAATGATGCATTGGCACAAACAGGTACAGCACTTGCGAATATCGGTAAGATTACATTTAATTATCGCAATGGAGAGGTATCGAATATTAAACCGTCATTGATTAATGTTAAAGACGTTGAAAATGTAACACCGAACAAAGCATTAGCTGAACAAATTAATCAAGCTGATCAAACATTTAGAGCACAAACTGCAGAGGTAATTATTCCAAACAATACCATTGATTTCAAAGGAGAAAGAGATGACGTTAGAACGCGTGAAACAAATTTAGGAAACGCGATTGCAGATGCTATGGAAGCGTATGGCGTTAAGAATTTCTCTAAAAAGACTGACTTTGCCGTGACAAATGGTGGAGGTATTCGTGCCTCTATCGCAAAAGGTAAGGTGACACGCTATGATTTAATCTCAGTATTACCATTTGGAAATACGATTGCGCAAATTGATGTAAAAGGTTCAGACGTCTGGACGGCTTTCGAACATAGTTTAGGCGCACCAACAACACAAAAGGACGGTAAGACAGTGTTAACAGCGAATGGCGGTTTACTACATATCTCTGATTCAATCCGTGTTTACTATGATATAAATAAACCGTCTGGCAAACGAATTAATGCTATTCAAATTTTAAATAAAGAGACAGGTAAGTTTGAAAATATTGATTTAAAACGTGTATATCACGTAACGATGAATGACTTCACAGCATCAGGTGGCGACGGATATAGTATGTTCGGTGGTCCTAGAGAAGAAGGTATTTCATTAGATCAAGTACTAGCAAGTTATTTAAAAACAGCTAACTTAGCTAAGTATGATACGACAGAACCACAACGTATGTTATTAGGTAAACCAGCAGTAAGTGAACAACCAGCTAAAGGACAACAAGGTAGCAAAGGTAGTAAGTCTGGTAAAGATACACAACCAATTGGTGACGACAAAGTGATGGATCCAGCGAAAAAACCAGCTCCAGGTAAAGTTGTATTGTTGCTAGCGCATAGAGGAACTGTTAGTAGCGGTACAGAAGGTTCTGGTCGCACAATAGAAGGAGCTACTGTATCAAGCAAGAGTGGGAAACAATTGGCTAGAATGTCAGTGCCTAAAGGTAGCGCGCATGAGAAACAGTTACCAAAAACTGGAACTAATCAAAGTTCAAGCCCAGAAGCGATGTTTGTATTATTAGCAGGTATAGGTTTAATCGCGACTGTACGACGTAGAAAAGCTAGCTAA
5'-nucleotidase77210.049383424-0.480959MetabolismBiosynthesis of cofactors, prosthetic groups, and carriers; Transport and binding proteinsPyridine nucleotides; OtherNAD nucleotidaseTIGR01530134.4Nucleosides and Nucleotides / Purines / Purine conversions / 5'-nucleotidase (EC 3.1.3.5); Nucleosides and Nucleotides / Pyrimidines / pyrimidine conversions / 5'-nucleotidase (EC 3.1.3.5); Virulence, Disease and Defense / Adhesion / Adhesins in Staphylococcus / Virulence-associated cell-wall-anchored protein SasH (LPXTG motif)PF028725_nucleotid_C5'-nucleotidase, C-terminal domainno clan definedno clan defined141.4CellwallLPxTG Cell-wall anchoredsignal peptide predicted057651132A0A0H2WY04YP_184935
MKALLLKTSVWLVLLFSVMGLWQVSNAAEQHTPMKAHAVTTIDKATTDKQQVPPTKEAAHHSGKEAATNVSASAQGTADDTNSKVTSNAPSNKPSTVVSTKVNETRDVDTQQASTQKPTHTATFKLSNAKTASLSPRMFAANAPQTTTHKILHTNDIHGRLAEEKGRVIGMAKLKTVKEQEKPDLMLDAGDAFQGLPLSNQSKGEEMAKAMNAVGYDAMAVGNHEFDFGYDQLKKLEGMLDFPMLSTNVYKDGKRAFKPSTIVTKNGIRYGIIGVTTPETKTKTRPEGIKGVEFRDPLQSVTAEMMRIYKDVDTFVVISHLGIDPSTQETWRGDYLVKQLSQNPQLKKRITVIDGHSHTVLQNGQIYNNDALAQTGTALANIGKITFNYRNGEVSNIKPSLINVKDVENVTPNKALAEQINQADQTFRAQTAEVIIPNNTIDFKGERDDVRTRETNLGNAIADAMEAYGVKNFSKKTDFAVTNGGGIRASIAKGKVTRYDLISVLPFGNTIAQIDVKGSDVWTAFEHSLGAPTTQKDGKTVLTANGGLLHISDSIRVYYDINKPSGKRINAIQILNKETGKFENIDLKRVYHVTMNDFTASGGDGYSMFGGPREEGISLDQVLASYLKTANLAKYDTTEPQRMLLGKPAVSEQPAKGQQGSKGSKSGKDTQPIGDDKVMDPAKKPAPGKVVLLLAHRGTVSSGTEGSGRTIEGATVSSKSGKQLARMSVPKGSAHEKQLPKTGTNQSSSPEAMFVLLAGIGLIATVRRRKAS
yes no polycistronic organisation predicted19808256; 19997597; 20108986; 21323324; 22035583; 22088393; 24439828
SACOL0025S. aureus COLSAUPAN000039000-CDSSACOL0025hypothetical proteinchromosome-3357634055480unknown3236738YP_184936911509
TTGTGCAGGCCGTTTGATCCGCCAATGACGAAAACAAAGTCGCTTTGCCCTTGGGTCATGCGTTGGTTCAATTCTTGGGCCAATCCTTCGGAAGATAGCATCTTTCCTTGTATTTCTAATGTAATGACTGTGGATTGTGGTTTGATTTTGGCTAGTATTCGTTGGCCTTCTTTTTCTTTTACTTGCTCAATTTCTTTGTCACTCATATTTTCTGGTGCTTTTTCGTCTGGAACTTCTATGATGTCTATCTTGGTGTATGGGCCTAAACGTTTTTCATATTCTGCTATGGCTTGCTTCCAATATTTCTCTTTTAGTTTCCCTACAGCTAAAATGGTGATTTTCATGTCGTTTGGTCCTCCAAATTGTTATCAACTTTCCAGTTATCCACAAGTTATTAACTTGTTCACACTGTTCCCTCTTATTATACCAATATTTTTTGCAGTTTTTGATATTTTCCTGACATTTATGCCCGATTTTTAG
hypothetical protein1598.0208118108.30.614465FIG01107958: hypothetical proteinCytoplasmic MembraneMulti-transmembraneno predicted signal peptide357651133A0A0H2WXN2YP_184936
MCRPFDPPMTKTKSLCPWVMRWFNSWANPSEDSIFPCISNVMTVDCGLILASIRWPSFSFTCSISLSLIFSGAFSSGTSMMSILVYGPKRFSYSAMACFQYFSFSFPTAKMVIFMSFGPPNCYQLSSYPQVINLFTLFPLIIPIFFAVFDIFLTFMPDF
no data available
SACOL0026SACOL_RS00155S. aureus COLSAUPAN000041000-CDSSACOL0026hypothetical proteinchromosome+34372356671296unknown3236745YP_184937911510
ATGAGACATAATATATTTTATAATAGGAGGGAATTTCAAATGATAGACAACTTTATGCAGGTCCTTAAATTAATTAAAGAGAAACGTACCAATAATGTAGTTAAAAAATCTGATTGGGATAAAGGTGATCTATATAAAACTTTAGTCCATGATAAGTTACCCAAGCAGTTAAAAGTGCATATAAAAGAAGATAAATATTCAGTTGTAGGGAAGGTTGCTACTGGGAACTATAGTAAAGTTCCTTGGATTTCAATATATGATGAGAATATAACAAAAGAAACAAAGGATGGATATTATTTGGTATATCTTTTTCATCCGGAAGGAGAAGGCATATACTTATCTTTGAATCAAGGATGGTCAAAGATAAGTGATATGTTTCCGCGGGATAAAAATGCTGCAAAACAAAGAGCATTAACTTTATCTTCCGAACTCAATAAATATATTACATCAAATGAATTTAATACTGGAAGATTTTATTACGCAGAAAATAAAGATTCATCTTATGATTTAAAAAATGATTATCCATCAGGATATTCTCATGGATCAATAAGATTCAAATATTATGATTTGAATGAAGGATTCACAGAAGAAGATATGCTAGAGGATTTAAAGAAATTTTTAGAACTATTTAATGAATTAGCTTCAAAAGTTACAAAAACATCCTATGATAGCTTGGTCAATAGCATAGACGAAATACAGGAAGACAGCGAAATTGAAGAAATTAGAACAGCACAAAAAGATAAGACACTCAAGGAAGTGGAAGCACCTAAAGGAATAATTCCAAAATATAAAAAAGGTGTATCAAAGACTACTAAAAATGATTCAGAAATTGAAAAATCAAATAAAGAGAATAAATTAACCGGTAAAGTTGGAGAAAAATTAGCGCTAAATTACTTTAATGAGCTAATTGATAATAAAATAGACGAAGATAAGAAAGAACAGTTTAGGAATATTTTAAATGATAATCCAGGCTCTCAACACGGTCATGGCTATGATTTAGTAGCTTTTGATCCAACAAATACAGATAAAGCTGTAGAAAAATTTATTGAAATTAAAACATCTACATCTTCTAGTATTGAGGAACCATTTTTTATGTCGCTAAATGAAATGTTTGCTATGAAAGAATATAAGCAGAAATATTTAATATTAAGAATATTTAATGTTTCCGGTAAAGAACCACAATTTTATTTTATAGATCCATATGCAAATTATTCTGAATTTAAAGATGTAGATGATCTCATTGACAAAGTATTTAATGTAGAAGCTATTCAGTATAAAGTTTTTGGCGAAAAATGA
hypothetical protein4315.8062750435.4-0.798376FIG01108167: hypothetical proteinPF12102DUF3578Domain of unknown function (DUF3578)no clan definedno clan defined179no significant predictionIntracellularno predicted signal peptide057651134A0A0H2WYD7YP_184937
MRHNIFYNRREFQMIDNFMQVLKLIKEKRTNNVVKKSDWDKGDLYKTLVHDKLPKQLKVHIKEDKYSVVGKVATGNYSKVPWISIYDENITKETKDGYYLVYLFHPEGEGIYLSLNQGWSKISDMFPRDKNAAKQRALTLSSELNKYITSNEFNTGRFYYAENKDSSYDLKNDYPSGYSHGSIRFKYYDLNEGFTEEDMLEDLKKFLELFNELASKVTKTSYDSLVNSIDEIQEDSEIEEIRTAQKDKTLKEVEAPKGIIPKYKKGVSKTTKNDSEIEKSNKENKLTGKVGEKLALNYFNELIDNKIDEDKKEQFRNILNDNPGSQHGHGYDLVAFDPTNTDKAVEKFIEIKTSTSSSIEEPFFMSLNEMFAMKEYKQKYLILRIFNVSGKEPQFYFIDPYANYSEFKDVDDLIDKVFNVEAIQYKVFGEK
yes no polycistronic organisation predicted19997597; 21323324; 24439828
SACOL0027SACOL_RS00160S. aureus COLSAUPAN000053000-CDSSACOL0027hypothetical proteinchromosome+3608236321240unknown3236746YP_184938911511
ATGAGTGATAATTTGTCATTATTCATTGACTATATCAATGATAATATAATCTATGGTAGTGAAATCAAACGGGAGAAATTAGAGAATTTATTTAATCAATTTGCTATAAAAAATGTTGAAAAGAACATTGTCTATGATGAACTGAAATCTTTAGATATTACAATCATTGAGTCACAGGATTCATATAAAAATAAATTGAAGAGATTATTTTCGGTTCTGTTGCAAAGTAAAAAAATATAG
hypothetical protein796.817089346.71-0.331646phenylacetic acid degradation protein paaNTIGR0228811.6hypothetical proteinPF17190RecG_NRecG N-terminal helical domainno clan definedno clan defined13.6no significant predictionIntracellularno predicted signal peptide057651135A0A0H2WXF2YP_184938
MSDNLSLFIDYINDNIIYGSEIKREKLENLFNQFAIKNVEKNIVYDELKSLDITIIESQDSYKNKLKRLFSVLLQSKKI
no data available no polycistronic organisation predicted
SACOL0028SACOL_RS00165S. aureus COLSAUPAN000054000tnpCDSSACOL0028IS431mec, transposasechromosome-3635337027675unknown3236747YP_184939911512
ATGAACTATTTCAGATATAAACAATTTAACAAGGATGTTATCACTGTAGCCGTTGGCTACTATCTAAGATATACATTGAGTTATCGTGATATATCTGAAATATTAAGGGAACGTGGTGTAAACGTTCATCATTCAACGGTCTACCGTTGGGTTCAAGAATATGCCCCAATTTTGTATCAAATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATCAAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATGCAGAGGGACATACATTAGATATTTGGTTGCGTAAGCAACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTCATTAAACAATTTGGTAAACCTCAAAAGGTAATTACAGATCAGGCACCTTCAACGAAGGTAGCAATGGCTAAAGTAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACATCGAAATATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGGTATCAAAGTATCAATACAGCAAAGAATACTTTAAAAGGTATTGAATGTATTTACGCTCTATATAAAAAGAACCGCAGGTCTCTTCAGATCTACGGATTTTCGCCATGCCACGAAATTAGCATCATGCTAGCAAGTTAA
IS431mec, transposase22410.42726915.2-0.601339Mobile element proteinPF13610DDE_Tnp_IS240DDE domainCL0219RNase_H133.2CytoplasmicIntracellularno predicted signal peptide057651136A0A0H2WXC3YP_184939
MNYFRYKQFNKDVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
no data available
SACOL0029S. aureus COLSAUPAN000097000mvaS2CDSSACOL0029HMG-CoA synthase, truncationchromosome+3728537452168unknown3236748YP_184940911513
ATGCTAGAATCTAGAGAGCAATTATCAGTCGAAGAATACGAAACATTCTTTAACAGATTTGATAATCAAGAATTTGATTTCGAACGTGAATTGACACAAGATCCATATTCAAAAGTATACTTATACAGTATAGAAGACCATATCAGAACATATAAGATAGAGAAATAA
HMG-CoA synthase, truncation554.194816950.56-1.08727hydroxymethylglutaryl-CoA synthaseTIGR0183517.1Hydroxymethylglutaryl-CoA synthase N-domain homolog (EC 2.3.3.10)CytoplasmicIntracellularno predicted signal peptide057651137A0A0H2WY09YP_184940
MLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK
no data available no polycistronic organisation predicted
SACOL0030SACOL_RS14360S. aureus COLSAUPAN000098000-CDSSACOL0030hypothetical proteinchromosome+3755037780231unknown3237118YP_184941911514
ATGCTTATTTTTTTATCTTACGATTTTGTACGTGCATGCTTGCCTAGGGGTATGGCTCGAGCCATTAGTCTCTCGCACATACTATTCCCTCAGGCGTCAGCACTTACAAAATCGGTTGTAATTTTCATTTTTATACGCATTCTTACTGAGATTATACTAATAAGAGGAATAGTAAAAGCAATTCTAAGTAAAATTGCAGATAAGAGGTTTGTTAAAAGCAGTTCTAAGTAA
hypothetical protein7611.65958537.420.893421Cytoplasmic MembraneN-terminally anchored (No CS)no predicted signal peptide157651382A0A0H2WYJ0YP_184941
MLIFLSYDFVRACLPRGMARAISLSHILFPQASALTKSVVIFIFIRILTEIILIRGIVKAILSKIADKRFVKSSSK
no data available no polycistronic organisation predicted
SACOL0031SACOL_RS00175S. aureus COLSAUPAN000099000ugpQCDSSACOL0031glycerophosphoryl diester phosphodiesterasechromosome+3832939072744unknown3236761YP_184942911515
ATGCTAACTGTATATGGACATAGAGGATTACCTAGTAAAGCTCCGGAAAATACAATTGCATCATTTAAAGCTGCTTCAGAAGTAGAAGGTATAAACTGGTTGGAGTTAGATGTTGCAATTACAAAAGATGAACAACTGATTATCATTCATGATGATTATTTAGAACGGACTACAAATATGTCCGGGGAAATAACTGAATTGAATTATGATGAAATTAAAGATGCTTCTGCAGGATCTTGGTTTGGTGAAAAATTCAAAGATGAACATTTGCCAACTTTCGATGATGTAGTAAAAATAGCAAATGAATATAATATGAATTTAAATGTAGAATTAAAAGGTATTACTGGACCGAATGGACTAGCACTTTCTAAAAGTATGGTTAAGCAAGTGGAAGAACAATTAACAAACTTAAATCAGAATCAAGAAGTGCTCATTTCAAGCTTTAATGTTGTGCTTGTTAAACTTGCAGAAGAAATCATGCCACAATATAACAGAGCAGTTATATTCCATACAACTTCGTTTCGTGAAGACTGGAGAACACTTTTAGATTACTGTAATGCTAAAATAGTAAACACTGAAGATGCCAAACTTACTAAAGCAAAAGTAAAAATGGTAAAAGAAGCGGGTTATGAATTGAACGTATGGACTGTAAACAAACCAGCACGTGCAAACCAACTTGCTAATTGGGGAGTTGATGGTATCTTTACAGACAATGCAGATAAAATGGTGCATTTGTCTCAATAG
glycerophosphoryl diester phosphodiesterase2474.6584827899.4-0.346559MetabolismEnergy metabolismMethanogenesistetrahydromethanopterin S-methyltransferase, subunit BTIGR0416612.4Carbohydrates / Sugar alcohols / Glycerol and Glycerol-3-phosphate Uptake and Utilization / Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)PF03009GDPDGlycerophosphoryl diester phosphodiesterase familyCL0384PLC151.9CytoplasmicIntracellularno predicted signal peptide057651138A0A0H2WXN6YP_184942
MLTVYGHRGLPSKAPENTIASFKAASEVEGINWLELDVAITKDEQLIIIHDDYLERTTNMSGEITELNYDEIKDASAGSWFGEKFKDEHLPTFDDVVKIANEYNMNLNVELKGITGPNGLALSKSMVKQVEEQLTNLNQNQEVLISSFNVVLVKLAEEIMPQYNRAVIFHTTSFREDWRTLLDYCNAKIVNTEDAKLTKAKVKMVKEAGYELNVWTVNKPARANQLANWGVDGIFTDNADKMVHLSQ
yes 46MicrobesOnline: SACOL0031 > SACOL003219997597; 24439828; 27344979
SACOL0032SACOL_RS00180S. aureus COLSAUPAN000100000maoCCDSmaoCMaoC domain-containing proteinchromosome+3916939597429unknown3236762YP_184943911516
ATGAAATACGATGATTTTATAGTAGGAGAAACATTCAAAACAAAAAGCCTTCATATTACAGAAGAAGAAATTATCCAATTTGCAACAACTTTTGATCCTCAATATATGCATATAGATAAAGAAAAAGCAGAACAAAGTAGATTTAAAGGTATCATTGCATCTGGCATGCATACACTTTCAATATCATTTAAATTATGGGTAGAAGAAGGTAAATACGGAGAAGAAGTTGTAGCAGGAACACAAATGAATAACGTTAAATTTATTAAACCTGTATACCCAGGTAATACATTGTACGTTATCGCTGAAATTACAAATAAGAAATCCATAAAAAAAGAAAATGGACTCGTTACAGTGTCACTTTCAACATACAATGAAAATGAAGAAATTGTATTTAAGGGAGAAGTAACAGCACTTATTAATAATTCATAA
MaoC domain-containing protein1425.280316136.3-0.311268phenylacetic acid degradation protein paaNTIGR0227860.4MaoC domain proteinPF01575MaoC_dehydratasMaoC like domainCL0050HotDog112.9no significant predictionIntracellularno predicted signal peptide057651139A0A0H2WYE2YP_184943
MKYDDFIVGETFKTKSLHITEEEIIQFATTFDPQYMHIDKEKAEQSRFKGIIASGMHTLSISFKLWVEEGKYGEEVVAGTQMNNVKFIKPVYPGNTLYVIAEITNKKSIKKENGLVTVSLSTYNENEEIVFKGEVTALINNS
yes MicrobesOnline: SACOL0031 > SACOL003219997597; 24439828
SACOL0033SACOL_RS00185S. aureus COLSAUPAN000101000mecACDSmecApenicillin-binding protein 2'chromosome-39643416492007unknown3236763YP_184944911517
ATGAAAAAGATAAAAATTGTTCCACTTATTTTAATAGTTGTAGTTGTCGGGTTTGGTATATATTTTTATGCTTCAAAAGATAAAGAAATTAATAATACTATTGATGCAATTGAAGATAAAAATTTCAAACAAGTTTATAAAGATAGCAGTTATATTTCTAAAAGCGATAATGGTGAAGTAGAAATGACTGAACGTCCGATAAAAATATATAATAGTTTAGGCGTTAAAGATATAAACATTCAGGATCGTAAAATAAAAAAAGTATCTAAAAATAAAAAACGAGTAGATGCTCAATATAAAATTAAAACAAACTACGGTAACATTGATCGCAACGTTCAATTTAATTTTGTTAAAGAAGATGGTATGTGGAAGTTAGATTGGGATCATAGCGTCATTATTCCAGGAATGCAGAAAGACCAAAGCATACATATTGAAAATTTAAAATCAGAACGTGGTAAAATTTTAGACCGAAACAATGTGGAATTGGCCAATACAGGAACAGCATATGAGATAGGCATCGTTCCAAAGAATGTATCTAAAAAAGATTATAAAGCAATCGCTAAAGAACTAAGTATTTCTGAAGACTATATCAAACAACAAATGGATCAAAATTGGGTACAAGATGATACCTTCGTTCCACTTAAAACCGTTAAAAAAATGGATGAATATTTAAGTGATTTCGCAAAAAAATTTCATCTTACAACTAATGAAACAGAAAGTCGTAACTATCCTCTAGAAAAAGCGACTTCACATCTATTAGGTTATGTTGGTCCCATTAACTCTGAAGAATTAAAACAAAAAGAATATAAAGGCTATAAAGATGATGCAGTTATTGGTAAAAAGGGACTCGAAAAACTTTACGATAAAAAGCTCCAACATGAAGATGGCTATCGTGTCACAATCGTTGACGATAATAGCAATACAATCGCACATACATTAATAGAGAAAAAGAAAAAAGATGGCAAAGATATTCAACTAACTATTGATGCTAAAGTTCAAAAGAGTATTTATAACAACATGAAAAATGATTATGGCTCAGGTACTGCTATCCACCCTCAAACAGGTGAATTATTAGCACTTGTAAGCACACCTTCATATGACGTCTATCCATTTATGTATGGCATGAGTAACGAAGAATATAATAAATTAACCGAAGATAAAAAAGAACCTCTGCTCAACAAGTTCCAGATTACAACTTCACCAGGTTCAACTCAAAAAATATTAACAGCAATGATTGGGTTAAATAACAAAACATTAGACGATAAAACAAGTTATAAAATCGATGGTAAAGGTTGGCAAAAAGATAAATCTTGGGGTGGTTACAACGTTACAAGATATGAAGTGGTAAATGGTAATATCGACTTAAAACAAGCAATAGAATCATCAGATAACATTTTCTTTGCTAGAGTAGCACTCGAATTAGGCAGTAAGAAATTTGAAAAAGGCATGAAAAAACTAGGTGTTGGTGAAGATATACCAAGTGATTATCCATTTTATAATGCTCAAATTTCAAACAAAAATTTAGATAATGAAATATTATTAGCTGATTCAGGTTACGGACAAGGTGAAATACTGATTAACCCAGTACAGATCCTTTCAATCTATAGCGCATTAGAAAATAATGGCAATATTAACGCACCTCACTTATTAAAAGACACGAAAAACAAAGTTTGGAAGAAAAATATTATTTCCAAAGAAAATATCAATCTATTAACTGATGGTATGCAACAAGTCGTAAATAAAACACATAAAGAAGATATTTATAGATCTTATGCAAACTTAATTGGCAAATCCGGTACTGCAGAACTCAAAATGAAACAAGGAGAAACTGGCAGACAAATTGGGTGGTTTATATCATATGATAAAGATAATCCAAACATGATGATGGCTATTAATGTTAAAGATGTACAAGATAAAGGAATGGCTAGCTACAATGCCAAAATCTCAGGTAAAGTGTATGATGAGCTATATGAGAACGGTAATAAAAAATACGATATAGATGAATAA
penicillin-binding protein 2'6689.1132576174-0.7128743.4.16.4Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanpenicillin-binding protein 2TIGR03423305Peptidoglycan Biosynthesis / penicillin-binding protein 2PF00905TranspeptidasePenicillin binding protein transpeptidase domainCL0013Beta-lactamase239.9
SACOL0303; SACOL2206
Cytoplasmic MembraneN-terminally anchored (No CS)no predicted signal peptide157651140A0A0H2WXF8YP_184944
MKKIKIVPLILIVVVVGFGIYFYASKDKEINNTIDAIEDKNFKQVYKDSSYISKSDNGEVEMTERPIKIYNSLGVKDINIQDRKIKKVSKNKKRVDAQYKIKTNYGNIDRNVQFNFVKEDGMWKLDWDHSVIIPGMQKDQSIHIENLKSERGKILDRNNVELANTGTAYEIGIVPKNVSKKDYKAIAKELSISEDYIKQQMDQNWVQDDTFVPLKTVKKMDEYLSDFAKKFHLTTNETESRNYPLEKATSHLLGYVGPINSEELKQKEYKGYKDDAVIGKKGLEKLYDKKLQHEDGYRVTIVDDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNMKNDYGSGTAIHPQTGELLALVSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKILTAMIGLNNKTLDDKTSYKIDGKGWQKDKSWGGYNVTRYEVVNGNIDLKQAIESSDNIFFARVALELGSKKFEKGMKKLGVGEDIPSDYPFYNAQISNKNLDNEILLADSGYGQGEILINPVQILSIYSALENNGNINAPHLLKDTKNKVWKKNIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAELKMKQGETGRQIGWFISYDKDNPNMMMAINVKDVQDKGMASYNAKISGKVYDELYENGNKKYDIDE
yes 19997597; 20108986; 20662103; 21166474; 21323324; 22556279; 22815485; 24439828
SACOL0034SACOL_RS00190S. aureus COLSAUPAN000102000mecR1CDSmecR1methicillin-resistance MecR1 regulatory proteinchromosome+4174942735987unknown3236764YP_184945911518
GTGTTATCATCTTTTTTAATGTTAAGTATAATCAGTTCATTGCTCACGATATGTGTAATTTTTTTAGTGAGAATGCTCTATATAAAATATACTCAAAATATTATGTCACATAAGATTTGGTTATTAGTGCTCGTCTCCACGTTAATTCCATTAATACCATTTTACAAAATATCGAATTTTACATTTTCAAAAGATATGATGAATCGAAATGTATCTGACACGACTTCTTCGGTTAGTCATATGTTAGATGGTCAACAATCATCTGTTACGAAAGACTTAGCAATTAATGTTAATCAGTTTGAGACCTCAAATATAACGTATATGATTCTTTTGATATGGGTATTTGGTAGTTTGTTGTGCTTATTTTATATGATTAAGGCATTCCGACAAATTGATGTTATTAAAAGTTCGTCATTGGAATCGTCATATCTTAATGAACGACTTAAAGTATGTCAAAGTAAGATGCAGTTCTACAAAAAGCATATAACAATTAGTTATAGTTCAAACATTGATAATCCGATGGTATTTGGTTTAGTGAAATCCCAAATTGTACTACCAACTGTCGTAGTCGAAACCATGAATGACAAAGAAATTGAATATATTATTCTACATGAACTATCACATGTGAAAAGTCATGACTTAATATTCAACCAGCTTTATGTTGTTTTTAAAATGATATTCTGGTTTAATCCTGCACTATATATAAGTAAAACAATGATGGACAATGACTGTGAAAAAGTATGTGATAGAAACGTTTTAAAAATTTTGAATCGCCATGAACATATACGTTATGGTGAATCGATATTAAAATGCTCTATTTTAAAATCTCAGCACATAAATAATGTGGCAGCACAATATTTACTAGGTTTTAATTCAAATATTAAAGAACGTGTTAAGTATATTGCACTTTATGATTCAATGCCTAAACCTAATCGAAACAAGCGTATTGTTGCGTATATTGTATGTAGTATATCGAGCTTCACATGA
methicillin-resistance MecR1 regulatory protein3289.4371338128.90.244817Methicillin resistance regulatory sensor-transducer MecR1, truncatedPF05569Peptidase_M56BlaR1 peptidase M56CL0126Peptidase_MA338.5Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide357651141A0A0H2WXC8YP_184945
MLSSFLMLSIISSLLTICVIFLVRMLYIKYTQNIMSHKIWLLVLVSTLIPLIPFYKISNFTFSKDMMNRNVSDTTSSVSHMLDGQQSSVTKDLAINVNQFETSNITYMILLIWVFGSLLCLFYMIKAFRQIDVIKSSSLESSYLNERLKVCQSKMQFYKKHITISYSSNIDNPMVFGLVKSQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMMDNDCEKVCDRNVLKILNRHEHIRYGESILKCSILKSQHINNVAAQYLLGFNSNIKERVKYIALYDSMPKPNRNKRIVAYIVCSISSFT
yes MicrobesOnline: SACOL0034 > SACOL003524439828
SACOL0035SACOL_RS00195S. aureus COLSAUPAN000103000rplLCDSSACOL0035hypothetical proteinchromosome+4270742967261unknown3236765YP_184946911519
TTGTATGTAGTATATCGAGCTTCACATGAAACAGCTAAAGAAGCTTTGGGCGATAAAGAGTTAAGAGCCATTGCACATGAGTTAACTAAAACAGTTAAGGATAACATGAGTGTTGATTGGTCTAAACGAGACAGTGCTAAAGCTAAAATGAGAGTTCAAGTTAGACGCCTATTAAAGAAATATGGCTATCCACCAGATCTTCAAAAAATGGCTGTGGAACAAGTTGTAGAGCAAGCAGAATTAATGGCAAGTCAGCAATAA
hypothetical protein869.976539923.43-0.682558DNA Metabolism / DNA Metabolism - no subcategory / Restriction-Modification System / Type I restriction-modification system, restriction subunit R (EC 3.1.21.3); DNA Metabolism / DNA Metabolism - no subcategory / Type I Restriction-Modification / Type I restriction-modification system, restriction subunit R (EC 3.1.21.3)PF11867DUF3387Domain of unknown function (DUF3387)no clan definedno clan defined105.6no significant predictionIntracellularno predicted signal peptide057651142A0A0H2WY14YP_184946
MYVVYRASHETAKEALGDKELRAIAHELTKTVKDNMSVDWSKRDSAKAKMRVQVRRLLKKYGYPPDLQKMAVEQVVEQAELMASQQ
no data available MicrobesOnline: SACOL0034 > SACOL0035
SACOL0036SACOL_RS00200S. aureus COLSAUPAN000107000-CDSSACOL0036IS1272 transposasechromosome-42958444811524unknown3236766YP_184947911520
ATGATGTTAAAAGTGATTCTATATGCCTACACACAATCTGTATTCTCAGGTCGTAAAATAGAAAAAATGCTTAATGATAGCATCCGAATGATGTGGCTATCACAAAATCAAAAACCTTCTTATAAAACAATTAATCAATTTAGAGTAAATCCAAAAGTAGATGCTTTATTAGAATCTTTATTTATTCAATTTTACAGTCAGTGTGTAAAACAAAATCTTATAGATGATAAAGCTATTTTTATTGATGGTACAAAAATTGAAGCAAATGCCAATCGATATACATTTGTATGGAAAAAGAGTATTCAAAACCATGAATCAAAGATGAATGAGGATTCTAAAGCCCTCTACCATGAATTGGTAACCAATAAAATCATACCGGAAATTAAAGAAGATCATGATAATGAATTAACAAAAGAAGAAATAGATTTGATTGGTAGTCACTTAGATAAAGAAATCGAAGATTTAAACCAACATATCAACAATGAAAAATGTACTAAAACAAGAAAACAAATACGTCTCAAAAGAACTAAAATCAAAAAATACAAAAAGCAAATCAATGATTATTTTGAGCGAAAGTATCGATACGAATTTCAAAAATCTATTTTAAAGGATAGAAATAGTTATTCTAAGACAGATTATGATGCGACATTTATGAGAATGAAAGAAGATCACATGAAAAATGGACAACTTAAGCCAGGGTATAATTTACAAATAGCAACAAATTCCCAATTTGTTTTATCTTATAATGTGTATCAAAATCCAACGGATACTAGAACGATGATTCCATTTTTAAATTCAATTCAAGAGACCTACGGTCATTTACCTGAATATATTGTAGCTGATGCAGGTTATGGTAGTGAATCAAATTATAAGGCAATTATAGATGACTTTAATCGAACGCCACTCATAACATATGGAATGTTTATAAAAGATAAAACTAAAAAATATAAAAGTGACATCTTTAATACTCAAAATTGGAACTATGACGAAATTAATGACGAATTCATTTGTCCGAATAATAAACGGCTAGGTTTTAAAAGATATGCCTATCGTCATGATAAGTATGGTTATAAGCGAGACTTCAAATTATATGAATGTGATGATTGTTCAGAATGTCCTCTGAAAAATCAATGTATGAACTTCAATTCAAAAACAAACAAAAAAATAATGAAGAATTATAACTGGGAATATTTTAAATCCCAAATTAACAAAAAGCTTTCAGAACCAGAAACAAAAAATATCTACAGTCAAAGAAAAATTGATGTGGAACCTGTTTTTGGATTTATGAAGGCTATTTTGGGTTTCACTCGGATGTCTGTCCGAGGACTCAATAAAGTCAAAAGAGAACTTGGTTTTGTATTAATGGCACTTAATATAAGAAAAGTAGTAGCTCAACGAGCTGAAAATAATCAAAAAATTTATAAAAAAGACAATTTCTATATTATTTCAATAGAAATTGTCTTTTTTCACTTATCCAAGAACTTTATGTCCCGGACTCATTATGATTTATTTTTTTATTGCTGA
IS1272 transposase5079.7458860733.3-0.768245putative transposasePF01609DDE_Tnp_1Transposase DDE domainCL0219RNase_H129.9no significant predictionIntracellularno predicted signal peptide057651143A0A0H2WXP0YP_184947
MMLKVILYAYTQSVFSGRKIEKMLNDSIRMMWLSQNQKPSYKTINQFRVNPKVDALLESLFIQFYSQCVKQNLIDDKAIFIDGTKIEANANRYTFVWKKSIQNHESKMNEDSKALYHELVTNKIIPEIKEDHDNELTKEEIDLIGSHLDKEIEDLNQHINNEKCTKTRKQIRLKRTKIKKYKKQINDYFERKYRYEFQKSILKDRNSYSKTDYDATFMRMKEDHMKNGQLKPGYNLQIATNSQFVLSYNVYQNPTDTRTMIPFLNSIQETYGHLPEYIVADAGYGSESNYKAIIDDFNRTPLITYGMFIKDKTKKYKSDIFNTQNWNYDEINDEFICPNNKRLGFKRYAYRHDKYGYKRDFKLYECDDCSECPLKNQCMNFNSKTNKKIMKNYNWEYFKSQINKKLSEPETKNIYSQRKIDVEPVFGFMKAILGFTRMSVRGLNKVKRELGFVLMALNIRKVVAQRAENNQKIYKKDNFYIISIEIVFFHLSKNFMSRTHYDLFFYC
yes no polycistronic organisation predicted24439828
SACOL0037SACOL_RS00205S. aureus COLSAUPAN000126000-CDSSACOL0037hypothetical proteinchromosome-4461745123507unknown3237004YP_184948911521
ATGAATACAATCAAAAGTACGATAAACACAGAAGCCATATTTAGCGATGATGAACAACACCGCTATTTACTCAAGAAAACATGGGATGAAAAGAAACCCGCTTGTACAGTGATAACGATGTACCCTCATTTAGATGGTGTATTATCACTCGATCTCACAACTGTTCTTATCCTCAATCAATTAGCTAATACTGAACAATATGGTGCTGTATATCTTGTAAATCTATTTTCAAATATTAGAACACCCGAAAACCTCAAACATATCAAAAATCCATACGATGAGCACACTGATATTCATTTGATGAAAGCGATTAGTGAAAGTGACACAGTGATTCTTGCTTATGGTGCCTATGCGAAGCGACCAGTTGTTATCGACCGTGTCGAACAAGTGATGGAAATGTTAAAACCTCATAAAAAGAAAGTAAAAAAGCTCATCAATCCAGTAACAAATGAAATTATGCATCCACTCAACCCTAAGGCACGTCAAAAATGGATTTTGAAATCATAG
hypothetical protein1689.4877619407.5-0.364881FIG01108090: hypothetical proteinPF07799DUF1643Protein of unknown function (DUF1643)no clan definedno clan defined85.4no significant predictionIntracellularno predicted signal peptide057652407A0A0H2WZP0YP_184948
MNTIKSTINTEAIFSDDEQHRYLLKKTWDEKKPACTVITMYPHLDGVLSLDLTTVLILNQLANTEQYGAVYLVNLFSNIRTPENLKHIKNPYDEHTDIHLMKAISESDTVILAYGAYAKRPVVIDRVEQVMEMLKPHKKKVKKLINPVTNEIMHPLNPKARQKWILKS
no data available MicrobesOnline: SACOL0037 < SACOL0038 < SACOL0039 < SACOL0040
SACOL0038SACOL_RS00210S. aureus COLSAUPAN000132000-CDSSACOL0038hypothetical proteinchromosome-4513845449312unknown3237005YP_184949911522
ATGAACATCAATCGATATATCACAAGAGGCATTAGTGAACACCTATCTCTAGATCTTCAAATCTTACTTTGGAACATGGTAAAAGAAAGAGATAATCAACCTGATACAGATTACCTACACATTTTTAGACTGAAAGAAGATGAGAATATACTTTCAATCATACATGAGCAAGAACAACCCACGTACAAATTGGAATATCACTATACAAACTATATAAAAAATCAAAATGCATTACCTAAGAAAGTCTACGTCATCCGAGAAGATGATGTAGATGTTTTTTATTATGTGATGCTTTTACCAGAAGAATACTAA
hypothetical protein1034.7185412654.3-0.623301FIG01107894: hypothetical proteinPF06124DUF960Staphylococcal protein of unknown function (DUF960)no clan definedno clan defined94.1no significant predictionIntracellularno predicted signal peptide057652408A0A0H2X0F6YP_184949
MNINRYITRGISEHLSLDLQILLWNMVKERDNQPDTDYLHIFRLKEDENILSIIHEQEQPTYKLEYHYTNYIKNQNALPKKVYVIREDDVDVFYYVMLLPEEY
no data available MicrobesOnline: SACOL0037 < SACOL0038 < SACOL0039 < SACOL0040
SACOL0039S. aureus COLSAUPAN000423000-CDSSACOL0039hypothetical proteinchromosome-454514554393unknown3237006YP_184950911523
ATGAATAATTGGATCAAAGTGGCACAAATATCTGTTACAGTCATTAACGAAGTGATTGACATCATGAAAGAAAAGCAAAATGGAGGAAAATAG
hypothetical protein309.37313400.98-0.18ExtracellularIntracellularno predicted signal peptide057652409A0A0H2X019YP_184950
MNNWIKVAQISVTVINEVIDIMKEKQNGGK
no data available MicrobesOnline: SACOL0037 < SACOL0038 < SACOL0039 < SACOL0040
SACOL0040SACOL_RS00215S. aureus COLSAUPAN000133000-CDSSACOL0040hypothetical proteinchromosome-4553645886351unknown3237007YP_184951911524
ATGAAAACAACCACTCAAGAACTCAAACAATATATAACTCGTCTATTCCAACTATCTAACAATGAAACATGGGAATGTGAAGCGTTAGAAGAAGCAGCAGAAAATATACTTCCTACTCGCTTTGTAGACCATACCCCACTTGCGCATCTTACACTTGACACTTATACCTACTATAATGATGAGCTACATGAGCTAAGTATCTATCCATTTCTAATGTACACCAATAACCAACTCATCAGTATCGGTTATCTGGATCATTTTGACATGGACTTTTTATATCTCACAGATACTAAAAATACGATTATCGATGAACGTCATCTACTAAAAGAAGGAGGGACTCGCCATGAATAA
hypothetical protein1164.4017513823.4-0.532759FIG01108299: hypothetical proteinPF06106SAUGIS. aureus uracil DNA glycosylase inhibitorno clan definedno clan defined232.3no significant predictionIntracellularno predicted signal peptide057652410A0A0H2X0Y2YP_184951
MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPTRFVDHTPLAHLTLDTYTYYNDELHELSIYPFLMYTNNQLISIGYLDHFDMDFLYLTDTKNTIIDERHLLKEGGTRHE
no data available MicrobesOnline: SACOL0037 < SACOL0038 < SACOL0039 < SACOL0040
SACOL0041S. aureus COLSAUPAN000444000ccrBpseudogeneccrBchromosome-46352479761625unknown3237008911525
ATGGATAAAATGAAGAAAAAGCTTGTAGGAGGCTACATTCGTGTGTCCACAGAGAGACAAGTAGAAGGTTATAGCATAGAGGGACAAATTACACAAATAGAGCAATATTGCCAATTTAACGGCTATGAACTTGTTGATATATATGCAGATCGGGGTATATCAGGAAAATCTATGAACCGTCCTGAATTACAGCGCATGTTAAATGATGCTAAAAATGGAAAATTAGACTGTGTTATGGTTTATAAAACAAATCGTTTGGCACGTAATACTTCCGATTTACTTACAATAGTCGAAGAACTTCATCGCCAAAATGTTGAATTTTTTAGCTTGTCTGAACGTATGGAAGTCAAAAATTCAACAGGCAAGTTAATGCTCCAGATACTTGCAAGTTTTTCCGAATTCGAAAGAAATACAATTTTAGAGAATATTTACACCGGACAACGTCAAAGAGCTTTAGAGGGCTATTATCAAGGCAATCTTCCATTAGGATATAATAACATACCTGATAATAAAAAAGAATTAATGATTAATCAACATGAAGCTAACATCGTTAAATATATCTTTGAATCTTATGCCAAAGGTCATGGTTATCGTAAAATAGCCAATGCATTCAATCACAAAGGCTATGTGACTAAAAAAGGCAATCCATTTAGTATTTCAGCTGTTACTTATATTCTCTCAAACCCATTCTATATTGGTAAAATTCAATTCGCGAAATACAAAGATTGGAATGATAAACGACGTAAAGGATTAAACGATAAGCCAGTAATCGCTGAAGGTAAACACACGCCTATTATTAGTCAATCATTATGGGATAAAGTGCAAGCACGTAAGAAACAAGTAAGTGAAAAACCACAAGTCCATGGTAAAGGAACCAATATTTTAACTGGAATAATTTCGTGTCCCCAATGTTCTGCACCTATGGCTGCGAGTAACACCACAAACACACTTAAAGATGGCACTAAAAACGTATTCGTTACTATTCGTGTAGTAATTTTCGAAATAAAGGCTCAAAGGTATGTTCTGCGAATAGTGTTAGAGCCGATGTCATTGAAAAATATGTTATGGACCAAATACTTGAAATTGTCAAAAGTGATAAAGTTCTCAAACAAGTTGTCGAACGTGTCAATCAAGAGAATCAAGTCGATGTAGCTGCACTTAACCATGATATTGCTTATAAACAACAACAATTTGATGAAATTAGCACTAAACTTAAAAATCTAATTCAAACCATCGAAGACAATCCAGACTTAACATCTGCACTCAAACCAACCATTCATCAATATGAAACACAACTGAATGATATCACAAACCAAATTAATCAACTCAAGCACCAACAAAATCAAGAGAAACCATTTTATGATACTAAACAAATCGCTGCTTTATTACAACGAATATTTCAAAATATAGAATCCATGGATAAATCACAGCTCAAAGCTTTGTACCTAACGGTTATTGACCGTATTGACATTCGTAAAGATGAGAATCATAAAAAGCAATTCTTTGTTACACTAAAACTTAATAATGAAATTATTAAACAACTTTTCAATAATAATAATCTAGACGAAGTGCTTCTCAGCACTTCGTCTTTGTTTTTGCCTCAAACACTCTACTTTCAAATATAA
0no predicted signal peptideno data available MicrobesOnline: SACOL0041 < SACOL0042
SACOL0042SACOL_RS00225S. aureus COLSAUPAN000445000ccrACDSccrA1cassette chromosome recombinase A1chromosome-47998493471350unknown3237009YP_184952911526
ATGAAACAAGCAATAGGTTACTTACGACAGAGCACTACAAAGCAACAATCCTTAGCAGCACAAAAACAAACCATCGAGGCATTAGCCAAAAAACATAATATTCAATACATTACCTTTTATAGCGATAAGCAATCAGGACGCACTGATAAGCGGAACGGTTACCAACAAATTACTGAACTGATTCAACAAGGACAATGTGATGTATTATGTTGTTACAGATTAAACCGACTTCATCGCAATCTTAAAAATGCATTAAAACTCATGAAATTGTGTCAAAAATACCATGTCCATATCTTAAGCGTTCATGATGGCTATTTTGATATGGATAAAGCATTCGATCGGCTCAAACTCAATATTTTCATCAGCTTGGCCGAACTAGAATCTGATAATATAGGCGAACAAGTCAAAAATGGAATCAAAGAAAAAGCGAAACAAGGTAAAATGATTACAACACATGCACCCTTTGGGTATCACTATCATAATGGTACTTTCACGATAGACACAGTAAAAGCACCAACAGTAAAAGCTGTGTTCAATTATTACCTTCAAGGTTATGGTTATAAAAAAATTGCGCAATACTTAGAAGCTGATGATAAATTCATTAATCGTAAGCCCTATCAAGTGCGTAATATTATCCTTAACCCTAATTACTGTGGCCGTGTTATCAATCAATACGGACAATATGAAAACATGTTCCCAGCTATTGTCAGTACAACGATATACGAAGAAGCTCAAGTTACCCGAACTCAGAAACCAGTAAAACGTAAGCCGTCAGAAAACCAACTCAAACAAAAAATCAAATGTCCTTATTGTGATTCAACACTAACTAATATGACCATTAGAAAAAAGCACCATACATTACGTTATTATGTTTGTCCTCAAAATATGAATGCATCTCGTTTTGTCTGTGAATTCAAAGGGATCAACGCACAAGAATTAGAAACAAGTGTTTTAGCGACTTGTCAGGACTTCTTTCAAAATCAACAGCTCTATTCAAAAATAAACCATACTATTCAACAACGACTCAAAAGACAAAGAGATATAGAAACTAAAACTACACTCAATCACGAGCAGCTGATAGAAAAATTAGCCCAAGACAAAATTGATGCAGAAACGTTCAGAGAACAAACGCAATCATTACGTCAGCAATCAAAACCTATATCATCAATCAGTACGTATCAAATTCGAAAAGCTTTCCAAAACATCATTCAACAACGTTTCACGCTAAACATGTTGTACCCCTATATTGATGAAATTAATATTTCTAAAAATAAAAGCCTCGCTGGCATCTATTTCAAAAATGAACCACTGAATATTGTAAAGCAGACTATGGAATTATCAATTGTATAA
cassette chromosome recombinase A14499.9384952580.1-0.659688Hypothetical proteinsConservedconserved hypothetical proteinTIGR0232815.1Cassette chromosome recombinase APF00239ResolvaseResolvase, N terminal domainno clan definedno clan defined127.4CytoplasmicIntracellularno predicted signal peptide057652411A0A0H2WZS7YP_184952
MKQAIGYLRQSTTKQQSLAAQKQTIEALAKKHNIQYITFYSDKQSGRTDKRNGYQQITELIQQGQCDVLCCYRLNRLHRNLKNALKLMKLCQKYHVHILSVHDGYFDMDKAFDRLKLNIFISLAELESDNIGEQVKNGIKEKAKQGKMITTHAPFGYHYHNGTFTIDTVKAPTVKAVFNYYLQGYGYKKIAQYLEADDKFINRKPYQVRNIILNPNYCGRVINQYGQYENMFPAIVSTTIYEEAQVTRTQKPVKRKPSENQLKQKIKCPYCDSTLTNMTIRKKHHTLRYYVCPQNMNASRFVCEFKGINAQELETSVLATCQDFFQNQQLYSKINHTIQQRLKRQRDIETKTTLNHEQLIEKLAQDKIDAETFREQTQSLRQQSKPISSISTYQIRKAFQNIIQQRFTLNMLYPYIDEINISKNKSLAGIYFKNEPLNIVKQTMELSIV
no data available MicrobesOnline: SACOL0041 < SACOL0042
SACOL0043SACOL_RS00230S. aureus COLSAUPAN000446000-CDSSACOL0043hypothetical proteinchromosome-49535513041770unknown3236995YP_184953911527
ATGAGTCATCATGACATTTTTAGACTAGGCCTATACCATTTAGATACAATGGGTTGGCATAAAACTATCCCACCTAAAAAAGATGGAGATGAGAAAAAAGTAGTGACTATGTCTAGTTGTATGGCTGTTGAAGCTAAATTTTGGCATGTCTTAGAAAATACAGAAAAAATAATTATTTCTAACGGTAAGGATAAAGAACATACATTTGACTCTGATATTTTAACAACTCGAAAGTTACCTTCCTTGATTAAATATGGTCACAGTATCAATGAAAATTATATAAAAGATTTGAGCTATGCACTACAATTAATGCGCGATGAAATGCCCACTTCTGATTTATATGATGGCTCGGGCATCATAGAAACACCCCACGGTTATATTGTAATGATAGATACCATTTATACATCTAAACAATATGATCAATTATCATCTTTAGATCCTATTGTCGATAGTGCTTATCCATTAGAGCCTAAAGGTACATTTAAAGATTGGTTAAATATGTATATTAACGAAGTCAAAGGTCATCTTCTTCTAGAGTTAGCGGTCGTATTTGGAATTTCTGCCTTAGTGACAAGCTTTCTGAAGTACAAACGTGAAATCGAATTTGCAGGAATTATCTTTAGTTTTACAGGCCAGTCATCAACTGGTAAATCAACAGCAGCAGCTTTAGCAGTATCCGTCGCTGGAAATCCAACTAAAGGTAATCAAACACTTTTTCGAAGTTGGAATGCCACACGTAATGCACTTGAAAGTTACTTGAGTAACAATTTTGGTATACCTATTGTATTTGATGAACTCTCATCAGCAACTTTTAAAGATACAACGGGGTTATTGTACTCTATCGCTGAAGGTCAAGGGCGTCAACGTTCCAATGTACACGGAGAAGTTAAAACGCCTAAGAATTGGGGCACTTCTGTGATTTCAACCTCTGAATACAGTATCTTTACTGATTCTGCTCAAAACGATGGATTACGTGTAAGAACCATCGAGATTAATGAACAATTTACTACAAATGCGACCAATGCTGACAATATCAAAAAAGCTGTGGCACTAAACCATGGTCATGTTTTACCGTTAGTAGCTCAATACCTTATAAATCGTGAAGATGAAGTTATTCAATGGTTTTACAAGGAAGTAGATTGGTTTGAAGCTAAATTGAACAGTGAAACAAACAATACAGGTATTCGTATGTTTAAGCGTTATGCAGTCATTACAACATCTGCGAAAATATTAGGTCGTGTTTTAGCTACAGATATTGATATCGCTAAAATCAGAGACTACTTTATTGATTATCATGCTCATACAGTCTCTGAACGATCACTGGCAGATAAAGCGATCGAAGTCATTACTCAATTTGTAGCACAAAACCGTGGTAAATTTTCTGATGATACAGCGTTAAAGAATATGTTCGAGAACTATGGACTAATTGCCTTAAAAGATAATCATATCGAAGTCAAAATCATTGCGTCTGTATTTAAAAATATGTTGTTAGAGCATCACTTCCAAGATGTTAATAATGTTGTTAATGCGCTAAGGGATAAAGGATTTATCGAATCTGACCATGATCGAATTACAACAAAAAGAACAGTCAAAGATGGCAATGGCAAAAAACAGTCACTTGTCTTTTACCATTTAAAGCTAGATTCAGAATATGCGTCTATTTTTGGTCTAACTAAAGATGCTGAACCTATTAAAGCTGAAATTAACTTGGATAACAAAAAGATACTTGAATCATGGAAAAAACAGAATGATGATTTAATTGATTTTTAA
hypothetical protein5896.5625366710.1-0.331919FIG01108399: hypothetical proteinPF06048DUF927Domain of unknown function (DUF927)CL0023P-loop_NTPase212.3no significant predictionIntracellularno predicted signal peptide057652412A0A0H2WZP5YP_184953
MSHHDIFRLGLYHLDTMGWHKTIPPKKDGDEKKVVTMSSCMAVEAKFWHVLENTEKIIISNGKDKEHTFDSDILTTRKLPSLIKYGHSINENYIKDLSYALQLMRDEMPTSDLYDGSGIIETPHGYIVMIDTIYTSKQYDQLSSLDPIVDSAYPLEPKGTFKDWLNMYINEVKGHLLLELAVVFGISALVTSFLKYKREIEFAGIIFSFTGQSSTGKSTAAALAVSVAGNPTKGNQTLFRSWNATRNALESYLSNNFGIPIVFDELSSATFKDTTGLLYSIAEGQGRQRSNVHGEVKTPKNWGTSVISTSEYSIFTDSAQNDGLRVRTIEINEQFTTNATNADNIKKAVALNHGHVLPLVAQYLINREDEVIQWFYKEVDWFEAKLNSETNNTGIRMFKRYAVITTSAKILGRVLATDIDIAKIRDYFIDYHAHTVSERSLADKAIEVITQFVAQNRGKFSDDTALKNMFENYGLIALKDNHIEVKIIASVFKNMLLEHHFQDVNNVVNALRDKGFIESDHDRITTKRTVKDGNGKKQSLVFYHLKLDSEYASIFGLTKDAEPIKAEINLDNKKILESWKKQNDDLIDF
no data available MicrobesOnline: SACOL0043 < SACOL0044
SACOL0044SACOL_RS00235S. aureus COLSAUPAN000447000-CDSSACOL0044hypothetical proteinchromosome-5130451600297unknown3236996YP_184954911528
ATGTCTTACAAGCAAGAAGATGATTTTAAAAAATTAAAAAATAGAATTTTAGGTATTTCAATTAATTTACCAGAAGGACAAACATTTACTTTCCATGACTTGAACCGTCGTGCAAATGTACAATGCTCAAAAGCTGTACAACAAAATGTTGGACGTTGGTTCGCATATTTTGTAAAACAAGCGCCACGTGTTCCATTTATTATTATCGGTAAAAATACCAATGGTCATTTAGTATATATGAAAGTCGGACCTAATCCACTCAATGATAGCAACCCTTCGAAAGGAGGTGTTCGCTAA
hypothetical protein9810.783411148.8-0.566327FIG01108228: hypothetical proteinPF07205DUF1413Domain of unknown function (DUF1413)no clan definedno clan defined57.4no significant predictionIntracellularno predicted signal peptide057652413A0A0H2X0H0YP_184954
MSYKQEDDFKKLKNRILGISINLPEGQTFTFHDLNRRANVQCSKAVQQNVGRWFAYFVKQAPRVPFIIIGKNTNGHLVYMKVGPNPLNDSNPSKGGVR
no data available MicrobesOnline: SACOL0043 < SACOL0044
SACOL0045SACOL_RS00240S. aureus COLSAUPAN000372000-CDSSACOL0045hypothetical proteinchromosome+51771533481578unknown3236997YP_184955911529
GTGTATGATTTTTTAGAATACTTACATCGTTATTGTATAAAATCAATTAATAATTGGGAGGCTGTTGCAGACATATCATGCAAAGTTGAACGTGGAAATGTTAGTACGGGCTATTATGTTAAACAAGATAGAATTGTAATAGATGATAGTGATATACCTCCAATTATTAAAATAAGTGGAAGTTATATAGCAGCAGACATATTAGTTACTAGATATTTAGATGGAATGGGTGAATTTATAAAGGTATCAAAATTAGATCAATCGAGCTATTACGAATGGTTTATGTTTGTTGAAGAAACGAGAAGAATATTTAGAGGTACAGAAATAGTTTATCAATTTTTAAAATATCTATTTACGCATACCTATGAACATAAAAATGAAGAAAAAAGAATAGAAAAACATATGAAAAACATTATCATAGATAATCAATTTAGAGGGCAGCATATCAATGATATCGTTCGTTTAGACATGAAAGATGATAATATGTTATTTTACAATTTTGATATATACGATACAAATGTTCTTTATAAAGAAATAGACGAGGAAAAATTACTTAGAATTTTAGATGAAATAAGTAATACTGACAATTACAAAGCGCTATTTAACATTATAAGTGAGAATCAAAAGAAATTTTGGAAATCAAATATTAAACCAATTGTAAGTGAATGTTCAGATGGTATAAATACAACCACATTTGATTTATATGCTTATGTAAATAAGTATATAAGTAATAAAATATTTGACTGTGATAATTATTTAATTACTAAAAATGAGGTTGTGGATTTCTATTTTAATCATGGTAGTGACTTTAATAATTTCAAGATGGGACAGACAGGCACAAAGTCCAAATTTAAGCAGGGAAATAAACTTAAAATACACGAATATATCATTGCAGTAACTTATGTAAATTTATTAAATCATTCATATATGAAATATATCAATGCTGAAAGTTACTATGACCCTAGCAAAAAAATAATAAAAGGAATGAAAAATGATTATCATAAATTTACAGATTCATTCAGTGATTTTGTAGAAATGGTGGACGATATAACATGGAGAATCCGTGATTCGTTTGATTATATTGGAGGATTAAAAAATAAAGAAATTAGCGAAGATGAGAACGAATATATCGAACAATTAATTCAATTTGTTATATTATCTAAATTCGGCTATATGAATGTGGAAAATCATTTTAATTATATTGAGAACTTAAATACACTTAATAACGAATTAACGACTATATTAAGAAGTGAATTCGCGCACATTTCAAATGATATGTATAATAATTTATTTGGTAATTTATTCGATGTTGTAAATACATGGAAAAAAGATTATTCAAATAATTTTTATAATAATACTCAGAATACTATACCTACAGAAAAATTAGATATAATATCTTCATTTATAAAACAATATGATAAACCAATTGAACGAGACGAACATGGCAAACACGTTAAAGCAAAAGTGTTTGAAGGTATAAGTGATTTTCATAAGCGTGTAAAAAAAGGATTTGATAATAATGATGTGCTATTGCATTTGAGATTGGAAATGAGTGTACATGAAAATAAGTATGATTAA
hypothetical protein5255.7504362590.2-0.567619hypothetical proteinPF08389Xpo1Exportin 1-like proteinCL0020TPR14.4CytoplasmicIntracellularno predicted signal peptide057652414A0A0H2X023YP_184955
MYDFLEYLHRYCIKSINNWEAVADISCKVERGNVSTGYYVKQDRIVIDDSDIPPIIKISGSYIAADILVTRYLDGMGEFIKVSKLDQSSYYEWFMFVEETRRIFRGTEIVYQFLKYLFTHTYEHKNEEKRIEKHMKNIIIDNQFRGQHINDIVRLDMKDDNMLFYNFDIYDTNVLYKEIDEEKLLRILDEISNTDNYKALFNIISENQKKFWKSNIKPIVSECSDGINTTTFDLYAYVNKYISNKIFDCDNYLITKNEVVDFYFNHGSDFNNFKMGQTGTKSKFKQGNKLKIHEYIIAVTYVNLLNHSYMKYINAESYYDPSKKIIKGMKNDYHKFTDSFSDFVEMVDDITWRIRDSFDYIGGLKNKEISEDENEYIEQLIQFVILSKFGYMNVENHFNYIENLNTLNNELTTILRSEFAHISNDMYNNLFGNLFDVVNTWKKDYSNNFYNNTQNTIPTEKLDIISSFIKQYDKPIERDEHGKHVKAKVFEGISDFHKRVKKGFDNNDVLLHLRLEMSVHENKYD
yes 19997597; 24439828
SACOL0046SACOL_RS00245S. aureus COLSAUPAN000509000-CDSSACOL0046metallo-beta-lactamasechromosome-53428547561329unknown3236998YP_184956911530
ATGTTTTTTAAACAATTTTATGATAAACATTTATCTCAAGCATCTTATTTAATCGGTTGTCAAAAAACTGGAGAAGCCATGATTATTGATCCTATTCGTGACTTATCTTCATATATTCGAGTTGCTGATGAAGAAGGTTTAACCATTACTCATGCAGCTGAAACACATATACATGCAGATTTTGCTTCAGGAATTAGAGATGTTGCTATAAAGTTAAATGCTAATATTTATGTATCGGGTGAAAGTGATGACACATTAGGTTATAAAAATATGCCTAACCACACTCATTTTGTTCAACATAATGACGATATTTATGTAGGAAATATAAAATTAAAAGTGCTTCATACACCGGGTCACACGCCAGAAAGTATAAGTTTTTTACTTACTGACGAAGGTGCTGGAGCACAAGTTCCAATGGGACTATTCAGTGGTGATTTTATTTTTGTAGGAGATATCGGTAGACCTGATTTACTAGAAAAAGCGGTTAAAGTAGAAGGATCATCTGAAATAGGCGCTAAACAAATGTTTAAATCGATTGAAAGTATTAAAGACTTGCCAGATTACATTCAAATTTGGCCTGGCCATGGCGCTGGTAGTCCTTGTGGTAAATCTTTAGGTGCTATTCCAACATCTACTCTTGGCTATGAAAAACAAACGAACTGGGCTTTTTCTGAAAATAACGAAGCTACCTTTATCGATAAACTCATTTCTGACCAACCTGCACCACCACATCATTTTGCACAAATGAAAAAAATTAATCAATTCGGTATGAATTTATATCAACCTTATACGGTTTATCCAGCTACAAATACAAACAGATTAACTTTTGATCTCCGCAGTAAGGAGGCTTATCATGGTGGACATATTGAAGGTACAATCAATATTCCATATGATAAAAATTTCATCAATCAAATTGGCTGGTATCTAAACTATGATCAAGAAATTAACTTGATTGGAGACTATCACCTTGTTTCAAAAGCAACACACACCTTACAACTCATTGGATACGATGATATTGCTGGATATCAATTACCGCAATCTAAGATTCAAACACGTTCCATTCATAGTGAAGACATTACAGGTAACGAATCACATATATTAGATGTACGTAATGATAATGAATGGAATAATGGCCACTTATCTCAAGCGGTTCATGTACCACACGGCAAACTTTTAGAAACAGATTTACCTTTCAATAAAAACGATGTTATTTATGTACACTGTCAGTCTGGCATTAGAAGTTCGATAGCTATTGGTATTTTAGAACACAAAGGTTATCACAACATTATTAATGTAAATGAAGGTTATAAAGATATACAACTTTCTTAA
metallo-beta-lactamase4425.9773649410-0.387104Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341374.5Zn-dependent hydroxyacylglutathione hydrolase / Polysulfide binding proteinPF00581RhodaneseRhodanese-like domainCL0031Phosphatase66.3CytoplasmicIntracellularno predicted signal peptide057652415A0A0H2X0Y8YP_184956
MFFKQFYDKHLSQASYLIGCQKTGEAMIIDPIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGAQVPMGLFSGDFIFVGDIGRPDLLEKAVKVEGSSEIGAKQMFKSIESIKDLPDYIQIWPGHGAGSPCGKSLGAIPTSTLGYEKQTNWAFSENNEATFIDKLISDQPAPPHHFAQMKKINQFGMNLYQPYTVYPATNTNRLTFDLRSKEAYHGGHIEGTINIPYDKNFINQIGWYLNYDQEINLIGDYHLVSKATHTLQLIGYDDIAGYQLPQSKIQTRSIHSEDITGNESHILDVRNDNEWNNGHLSQAVHVPHGKLLETDLPFNKNDVIYVHCQSGIRSSIAIGILEHKGYHNIINVNEGYKDIQLS
yes MicrobesOnline: SACOL0046 < SACOL004724439828
SACOL0047SACOL_RS00250S. aureus COLSAUPAN000110000-CDSSACOL0047hypothetical proteinchromosome-54775558421068unknown3236999YP_184957911531
ATGTCACAATATAAAACGAAACACATTAATGATTTCACTAAAAAAGAATTACAAGAATTGAGTTCTAAGGGTCAATTAATTGACGTTCGACATCCTGAAGAATTTGAATTAGGACACATTAAAAACGCTTTATTACATTCAGTTGAAAATATAGAGACTTTTAAACAAAGCAAAAATAAAACTTACTATATCTATTGTAAAAGTGGTAATAGAAGTAGAAAAGCCAGTCAATTTCTTGCACAACGCGGATACGATGTAGTGAATTTAGACGGAGGTTATACCGCATACGAACAACAACATCATAATGATAATTTATCTAAAGTAAAAGAAGATAGAGAAATTAAAGATAATCGTAAGACATTCAATTATAGTAATCTACAGTGTCCAGGACCTATTGTTAATATTAGTAAAGAAATCAAAAACATCGCTATTGGCGATCAAATAGAAGTTGTTGTGACTGATCACGGATTTTTAAATGATATTAAAAGTTGGGTCAAACAAACTGGACATACGCTTGTTAGACTCAACGATTTTGGCAATGAAATTCGCGCTATTATTCAAAAAGAAGAAAATAAAAATATAGAAGTGACACACACGAAAAGTGGAACAACAATTGTTTTATTTAGCGGCGAGCTAGATAAAGCAGTTGCAGCAATGATTATTGCTAATGGTGCTAAAGCTGCAGGTAGAGATGTAACCATTTTTTGCACATTTTGGGGCTTAAATGCACTTAAAAAAATTCAAAGTCAACGTATTAAGAAAAAAGGTATTGCAAAACTTTTTGACTTCATGCTTCCAAATTCACCAATTAACATGCCTATTTCTAAAATGAATATGTTTGGTTTAGGCAATCTAATGATGCGTTATGTCATGAAAAAGAAAAATGTCGATACTTTACCTTCTCTTATTGATCAAGCAGTTGAGCAAGGTGTTAAACTTATCGCTTGTACAATGAGTATGGATGTGATGGGCATTACAAAAGAAGAACTACGTGATGATGTAGAATACGGTGGCGTAGGTGCATATATTGGATATACAGAACAAGCTAATCACAATTTATTTATATAA
hypothetical protein3559.2967340204.9-0.434085Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA 2-selenouridine synthaseTIGR0316737.6Disulfide bond regulatorPF13686DrsE_2DsrE/DsrF/DrsH-like familyCL0394DsrEFH-like184.7CytoplasmicIntracellularno predicted signal peptide057652416A0A0H2WZT3YP_184957
MSQYKTKHINDFTKKELQELSSKGQLIDVRHPEEFELGHIKNALLHSVENIETFKQSKNKTYYIYCKSGNRSRKASQFLAQRGYDVVNLDGGYTAYEQQHHNDNLSKVKEDREIKDNRKTFNYSNLQCPGPIVNISKEIKNIAIGDQIEVVVTDHGFLNDIKSWVKQTGHTLVRLNDFGNEIRAIIQKEENKNIEVTHTKSGTTIVLFSGELDKAVAAMIIANGAKAAGRDVTIFCTFWGLNALKKIQSQRIKKKGIAKLFDFMLPNSPINMPISKMNMFGLGNLMMRYVMKKKNVDTLPSLIDQAVEQGVKLIACTMSMDVMGITKEELRDDVEYGGVGAYIGYTEQANHNLFI
yes MicrobesOnline: SACOL0046 < SACOL004724439828
SACOL0048SACOL_RS00255S. aureus COLSAUPAN000111000-CDSSACOL0048hypothetical proteinchromosome+5598156241261unknown3237000YP_184958911532
TTGGAATATAATAAAAAGATGATTAATCGTATTCATCGCATACAAGGACAGCTTAATGGAGTCATTAAAATGATGGAGGAAGAAAAAAATTGTAAAGACGTCATTAGTCAATTAAGTGCATCTAAAAGTTCTATTCAACGTTTAATGGGTATTATTATTAGCGAGAACTTAGTAGAATGCGTCAAAATGTCTGAAGAAAATAGTGAAGATTCTCAGGCACTAATTAATGAAGCTGTTGAATTATTAATAAAAAGTAAATGA
hypothetical protein865.886169811.4-0.359302FIG007303: uncharacterized proteinPF02583Trns_repr_metalMetal-sensitive transcriptional repressorno clan definedno clan defined79.9no significant predictionIntracellularno predicted signal peptide057652417A0A0H2WZQ1YP_184958
MEYNKKMINRIHRIQGQLNGVIKMMEEEKNCKDVISQLSASKSSIQRLMGIIISENLVECVKMSEENSEDSQALINEAVELLIKSK
yes MicrobesOnline: SACOL0048 > SACOL004924439828
locus tagold locus tagnew locus tagorganismpan locus tagpan gene symboltypesymbolsynonymproductcommentrepliconstrandstartendgene lengthessentialGene IDgene RefSeqMicrobesOnlineDNAdescriptionprotein lengththeoretical pItheoretical MWGRAVYECTIGRFAM Meta RoleTIGRFAM Main RoleTIGRFAM Sub RoleTIGRFAM functionTIGRFAMTIGRFAM HMM scoreTheSEEDPFAM AccessionPFAMPFAM descriptionPFAM clan accessionPFAM clanPFAM HMM scoreeffectorinteraction partnersPSORTbLocatePSignalPtransmembrane helicesprotein GIUniProtprotein RefSeqprotein sequenceprotein peptides detectedprotein copies per celloperonregulatorpubmed
SACOL_RS00025SACOL0001S. aureus COLSAUPAN000006000dnaACDSSACOL_RS00025chromosomal replication initiator protein DnaAchromosome+54419051362unknownWP_001290433
ATGTCGGAAAAAGAAATTTGGGAAAAAGTGCTTGAAATTGCTCAAGAAAAATTATCAGCTGTAAGTTACTCAACTTTCCTAAAAGATACTGAGCTTTACACGATTAAAGATGGTGAAGCTATCGTATTATCGAGTATTCCTTTTAATGCAAATTGGTTAAATCAACAATATGCTGAAATTATCCAAGCAATCTTATTTGATGTTGTAGGCTATGAAGTTAAACCTCACTTTATTACTACTGAAGAATTAGCAAATTATAGTAATAATGAAACTGCTACTCCAAAAGAAACAACAAAACCTTCTACTGAAACAACTGAGGATAATCATGTGCTTGGTAGAGAGCAATTCAATGCCCATAACACATTTGACACTTTTGTAATCGGACCCGGTAACCGCTTTCCACATGCAGCGAGTTTAGCTGTGGCCGAAGCACCAGCCAAAGCGTACAATCCATTATTTATCTATGGAGGTGTTGGTTTAGGAAAAACCCATTTAATGCATGCCATTGGTCATCATGTTTTAGATAATAATCCAGATGCCAAAGTGATTTACACATCAAGTGAAAAATTCACAAATGAATTTATTAAATCAATTCGTGATAACGAAGGTGAAGCTTTCAGAGAAAGATATCGTAATATCGACGTCTTATTAATCGATGATATTCAGTTCATACAAAACAAGGTACAAACACAAGAAGAATTTTTCTATACTTTTAATGAATTGCATCAGAATAACAAGCAAATAGTTATTTCGAGTGATCGACCACCAAAGGAAATTGCACAATTAGAAGACCGATTACGTTCACGCTTTGAATGGGGGCTAATTGTTGATATTACGCCACCAGATTATGAAACTCGAATGGCAATTTTGCAGAAGAAAATTGAAGAAGAAAAATTAGATATTCCACCAGAAGCTTTAAATTATATAGCAAATCAAATTCAATCTAATATTCGTGAATTAGAAGGTGCATTAACACGTTTACTTGCATATTCACAATTATTAGGAAAACCAATTACAACTGAATTAACTGCTGAAGCTTTAAAAGATATCATTCAAGCACCAAAATCTAAAAAGATTACCATCCAAGATATTCAAAAAATTGTAGGCCAGTACTATAATGTTAGAATTGAAGATTTCAGTGCAAAAAAACGTACAAAGTCAATTGCATATCCGCGTCAAATAGCTATGTACTTGTCTAGAGAGCTTACAGATTTCTCATTACCTAAAATTGGTGAAGAATTTGGTGGGCGTGATCATACGACCGTCATTCATGCTCATGAAAAAATATCTAAAGATTTAAAAGAAGATCCTATTTTTAAACAAGAAGTAGAGAATCTTGAAAAAGAAATAAGAAATGTATAA
chromosomal replication initiator protein DnaA4535.1162651965.3-0.488742Genetic information processingDNA metabolismDNA replication, recombination, and repairchromosomal replication initiator protein DnaATIGR00362594.7PF00308Bac_DnaABacterial dnaA proteinCL0023P-loop_NTPase340.4Cytoplasmicno predicted signal peptide0447213177WP_001290433
MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
no data available
SACOL_RS00030SACOL0002S. aureus COLSAUPAN000007000dnaNCDSSACOL_RS00030DNA polymerase III subunit betachromosome+218333161134unknownWP_000969811
ATGATGGAATTCACTATTAAAAGAGATTATTTTATTACACAATTAAATGACACATTAAAAGCTATTTCACCAAGAACAACATTACCTATATTAACTGGTATCAAAATCGATGCGAAAGAACATGAAGTTATATTAACTGGTTCAGACTCTGAAATTTCAATAGAAATCACTATTCCTAAAACTGTAGATGGCGAAGATATTGTCAATATTTCAGAAACAGGCTCAGTAGTACTTCCTGGACGATTCTTTGTTGATATTATAAAAAAATTACCTGGTAAAGATGTTAAATTATCTACAAATGAACAATTCCAGACATTAATTACATCAGGTCATTCTGAATTTAATTTAAGTGGCTTAGATCCAGATCAATATCCTTTATTACCTCAAGTTTCTAGAGATGACGCAATTCAATTGTCGGTAAAAGTGCTTAAAAACGTGATTGCACAAACAAATTTTGCAGTGTCCACCTCAGAAACACGCCCAGTACTAACTGGTGTGAACTGGCTTATACAAGAAAATGAATTAATATGCACAGCGACTGACTCACACCGCTTGGCTGTAAGAAAGTTGCAGTTAGAAGATGTTTCTGAAAACAAAAATGTCATCATTCCAGGTAAGGCTTTAGCTGAATTAAATAAAATTATGTCTGACAATGAAGAAGACATTGATATCTTCTTTGCTTCAAACCAAGTTTTATTTAAAGTTGGAAATGTGAACTTTATTTCTCGATTATTAGAAGGACATTATCCTGATACAACACGTTTATTCCCTGAAAACTATGAAATTAAATTAAGTATAGACAATGGGGAGTTTTATCATGCGATTGATCGTGCCTCTTTATTAGCGCGTGAAGGTGGTAATAACGTTATTAAATTAAGTACAGGTGATGACGTTGTTGAATTGTCTTCTACATCACCAGAAATTGGTACTGTAAAAGAAGAAGTTGATGCAAACGATGTTGAAGGTGGTAGCCTGAAAATTTCATTCAACTCTAAATATATGATGGATGCTTTAAAAGCAATCGATAATGATGAGGTTGAAGTTGAATTCTTCGGTACAATGAAACCATTTATTCTAAAACCAAAAGGTGACGACTCGGTAACGCAATTAATTTTACCAATCAGAACTTACTAA
DNA polymerase III subunit beta3774.4028441913.3-0.1615382.7.7.7Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, beta subunitTIGR00663375.1PF00712DNA_pol3_betaDNA polymerase III beta subunit, N-terminal domainCL0060DNA_clamp184Cytoplasmicno predicted signal peptide0446892555WP_000969811
MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIRTY
no data available
SACOL_RS00035SACOL0003S. aureus COLSAUPAN000009000-CDSSACOL_RS00035RNA-binding proteinchromosome+36973942246unknownWP_001789359
GTGATTATTTTGGTTCAAGAAGTTGTAGTAGAAGGAGACATTAATTTAGGTCAATTTCTAAAAACAGAAGGGATTATTGAATCTGGTGGTCAAGCAAAATGGTTCTTGCAAGACGTTGAAGTATTAATTAATGGAGTGCGTGAAACACGTCGCGGTAAAAAGTTAGAACATCAAGATCGTATAGATATCCCAGAATTACCTGAAGATGCTGGTTCTTTCTTAATCATTCATCAAGGTGAACAATGA
RNA-binding protein814.355789137.35-0.197531Genetic information processingDNA metabolismDNA replication, recombination, and repairS4 domain protein YaaATIGR0298890PF13275S4_2S4 domainCL0492S474.4
SACOL_RS00470; SACOL_RS00620; SACOL_RS01040; SACOL_RS01215; SACOL_RS02145; SACOL_RS02285; SACOL_RS02640; SACOL_RS02875; SACOL_RS02980; SACOL_RS03020; SACOL_RS03025; SACOL_RS03035; SACOL_RS03050; SACOL_RS03065; SACOL_RS03075; SACOL_RS03080; SACOL_RS03275; SACOL_RS03415; SACOL_RS03635; SACOL_RS03705; SACOL_RS03755; SACOL_RS03810; SACOL_RS03830; SACOL_RS04080; SACOL_RS04310; SACOL_RS04315; SACOL_RS04320; SACOL_RS04325; SACOL_RS04330; SACOL_RS04495; SACOL_RS04925; SACOL_RS04950; SACOL_RS05135; SACOL_RS05205; SACOL_RS05470; SACOL_RS05570; SACOL_RS05610; SACOL_RS05900; SACOL_RS06175; SACOL_RS06365; SACOL_RS06445; SACOL_RS06515; SACOL_RS06770; SACOL_RS06965; SACOL_RS07175; SACOL_RS07320; SACOL_RS07705; SACOL_RS07720; SACOL_RS07920; SACOL_RS08085; SACOL_RS08115; SACOL_RS08210; SACOL_RS08270; SACOL_RS08345; SACOL_RS08595; SACOL_RS08905; SACOL_RS08910; SACOL_RS09000; SACOL_RS09010; SACOL_RS09125; SACOL_RS09230; SACOL_RS09385; SACOL_RS09430; SACOL_RS10175; SACOL_RS10250; SACOL_RS10530; SACOL_RS10850; SACOL_RS10940; SACO
Cytoplasmicno predicted signal peptide0WP_001789359
MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ
no data available 21166474
SACOL_RS00040SACOL0004S. aureus COLSAUPAN000010000recFCDSSACOL_RS00040DNA replication and repair protein RecFchromosome+393950511113unknownWP_000775113
ATGAAGTTAAATACACTCCAATTAGAAAATTATCGTAACTATGATGAGGTTACGTTGAAATGTCATCCTGACGTGAATATCCTCATTGGAGAAAATGCACAAGGAAAGACAAATTTACTTGAATCAATTTATACCTTAGCTTTAGCAAAAAGTCATAGAACGAGTAATGATAAGGAACTCATACGTTTTAATGCTGATTATGCTAAAATAGAAGGTGAGCTTAGTTATAGACACGGCACGATGCCATTAACAATGTTTATAACTAAAAAAGGTAAACAAGTCAAAGTGAATCACTTAGAGCAAAGTCGTCTAACTCAATATATTGGACACCTCAATGTGGTTCTATTTGCGCCAGAAGATTTGAATATTGTAAAAGGCTCTCCTCAAATAAGACGACGCTTTATAGATATGGAGTTGGGCCAAATTTCTGCTGTTTACTTAAATGATTTAGCTCAATACCAACGTATTTTAAAGCAAAAGAATAATTACTTAAAGCAGTTACAATTAGGCCAAAAAAAGGACTTAACAATGTTGGAAGTATTAAATCAGCAGTTTGCTGAATATGCAATGAAAGTAACTGATAAACGTGCACATTTTATTCAAGAGCTAGAGTCGTTAGCTAAACCGATTCATGCTGGTATCACAAATGATAAAGAAGCGTTGTCGCTGAATTATTTACCTAGTCTTAAATTTGATTATGCTCAAAATGAAGCGGCACGACTTGAAGAAATTATGTCTATTCTTAGCGATAATATGCAAAGAGAAAAAGAACGAGGCATTAGCTTATTCGGACCACATCGAGATGATATAAGTTTTGATGTGAATGGCATGGATGCTCAAACATATGGTTCTCAAGGACAGCAACGTACAACGGCTTTGTCCATTAAATTAGCTGAAATTGAGTTAATGAATATCGAAGTTGGGGAATATCCCATCTTATTATTAGACGATGTACTCAGTGAATTAGATGATTCGCGTCAAACGCATTTATTAAGTACGATTCAGCATAAAGTACAAACATTTGTCACTACGACATCTGTAGATGGTATTGATCATGAAATCATGAATAACGCTAAATTGTATCGTATTAATCAAGGTGAAATTATAAAGTAA
DNA replication and repair protein RecF3706.4468842415.1-0.444054Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA replication and repair protein RecFTIGR00611474.6PF02463SMC_NRecF/RecN/SMC N terminal domainCL0023P-loop_NTPase60.4
SACOL_RS01040; SACOL_RS01135; SACOL_RS03025; SACOL_RS03030; SACOL_RS03035; SACOL_RS03040; SACOL_RS03075; SACOL_RS03080; SACOL_RS04330; SACOL_RS04840; SACOL_RS05605; SACOL_RS05630; SACOL_RS05635; SACOL_RS05645; SACOL_RS06140; SACOL_RS06420; SACOL_RS06505; SACOL_RS06575; SACOL_RS07385; SACOL_RS07390; SACOL_RS07525; SACOL_RS08680; SACOL_RS08830; SACOL_RS08865; SACOL_RS08905; SACOL_RS08930; SACOL_RS08995; SACOL_RS09045; SACOL_RS09125; SACOL_RS10255; SACOL_RS10840; SACOL_RS11435; SACOL_RS11645; SACOL_RS11655; SACOL_RS11685; SACOL_RS11695; SACOL_RS11705; SACOL_RS11710; SACOL_RS11720; SACOL_RS11735; SACOL_RS11750; SACOL_RS11755; SACOL_RS11765; SACOL_RS11770; SACOL_RS11775; SACOL_RS11780; SACOL_RS13415; SACOL_RS13725
Cytoplasmicno predicted signal peptide0446697767WP_000775113
MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKLYRINQGEIIK
no data available 21166474
SACOL_RS00045SACOL0005S. aureus COLSAUPAN000011000gyrBCDSSACOL_RS00045DNA gyrase subunit Bchromosome+506169951935unknownWP_000255576
ATGGTGACTGCATTGTCAGATGTAAACAACACGGATAATTATGGTGCTGGGCAAATACAAGTATTAGAAGGTTTAGAAGCAGCACGTAAAAGACCAGGTATGTATATAGGATCGACTTCAGAGAGAGGTTTGCACCATTTAGTGTGGGAAATTGTCGATAATAGTATCGATGAAGCATTAGCTGGTTATGCAAATCAAATTGAAGTTGTTATTGAAAAAGATAACTGGATTAAAGTAACGGATAACGGACGTGGTATCCCAGTTGATATTCAAGAAAAAATGGGACGTCCAGCTGTCGAAGTTATTTTAACTGTTTTACATGCTGGTGGTAAATTTGGCGGTGGCGGATACAAAGTATCTGGTGGTTTACATGGTGTTGGTTCATCAGTTGTAAACGCATTGTCACAAGACTTAGAAGTATATGTACACAGAAATGAGACTATATATCATCAAGCATATAAAAAAGGTGTACCTCAATTTGACTTAAAAGAAGTTGGCACAACTGATAAGACAGGTACTGTCATTCGTTTTAAAGCAGATGGAGAAATCTTCACAGAGACAACTGTATACAACTATGAAACATTACAGCAGCGTATTAGAGAGCTTGCTTTCTTAAACAAAGGAATTCAAATCACATTAAGAGATGAACGTGATGAAGAAAACGTTAGAGAAGACTCCTATCACTATGAGGGCGGTATTAAATCGTACGTTGAGTTATTGAACGAAAATAAAGAACCTATTCATGATGAGCCAATTTATATTCATCAATCTAAAGATGATATTGAAGTAGAAATTGCGATTCAATATAACTCAGGATATGCCACAAATCTTTTAACTTACGCAAATAACATTCATACGTATGAAGGTGGTACGCATGAAGACGGATTCAAACGTGCATTAACGCGTGTCTTAAATAGTTATGGTTTAAGTAGCAAGATTATGAAAGAAGAAAAAGATAGACTTTCTGGTGAAGATACACGTGAAGGTATGACAGCAATTATATCTATCAAACATGGTGATCCTCAATTCGAAGGTCAAACGAAGACAAAATTAGGTAATTCTGAAGTGCGTCAAGTTGTAGATAAATTATTCTCAGAGCACTTTGAACGATTTTTATATGAAAATCCACAAGTCGCACGTACAGTGGTTGAAAAAGGTATTATGGCGGCACGTGCACGTGTTGCTGCGAAAAAAGCGCGTGAAGTAACACGTCGTAAATCAGCGTTAGATGTAGCAAGCCTTCCAGGTAAATTAGCCGATTGCTCTAGTAAAAGTCCTGAAGAATGTGAGATTTTCTTAGTCGAAGGGGACTCTGCCGGGGGGTCTACAAAATCTGGTCGTGACTCTAGAACGCAGGCGATTTTACCATTACGAGGTAAGATATTAAATGTTGAAAAAGCACGATTAGATAGAATTTTGAATAACAATGAAATTCGTCAAATGATCACAGCATTTGGTACAGGAATCGGTGGCGACTTTGATCTAGCGAAAGCAAGATATCACAAAATCGTCATTATGACTGATGCCGATGTGGATGGAGCGCATATTAGAACATTGTTATTAACATTCTTCTATCGATTTATGAGACCGTTAATTGAAGCAGGCTATGTGTATATTGCACAGCCACCGTTGTATAAACTGACACAAGGTAAACAAAAGTATTATGTATACAATGATAGGGAACTTGATAAACTTAAATCTGAATTGAATCCAACACCAAAATGGTCTATTGCACGATACAAAGGTCTTGGAGAAATGAATGCAGATCAATTATGGGAAACAACAATGAACCCTGAGCACCGCGCTCTTTTACAAGTAAAACTTGAAGATGCGATTGAAGCGGACCAAACATTTGAAATGTTAATGGGTGACGTTGTAGAAAACCGTAGACAATTTATAGAAGATAATGCAGTTTATGCAAACTTAGACTTCTAA
DNA gyrase subunit B6445.6814572511.3-0.4936345.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, B subunitTIGR01059991.1PF00204DNA_gyraseBDNA gyrase BCL0329S5211.1
SACOL_RS00050; SACOL_RS03075; SACOL_RS06575; SACOL_RS08930
Cytoplasmicno predicted signal peptide0446177721WP_000255576
MVTALSDVNNTDNYGAGQIQVLEGLEAARKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
no data available 21166474
SACOL_RS00050SACOL0006S. aureus COLSAUPAN000012000gyrACDSSACOL_RS00050DNA gyrase subunit Achromosome+703296952664unknownWP_000819088
ATGGCTGAATTACCTCAATCAAGAATAAATGAACGAAATATTACCAGTGAAATGCGTGAATCATTTTTAGATTATGCGATGAGTGTTATCGTTGCTCGTGCATTGCCAGATGTTCGTGACGGTTTAAAACCAGTACATCGTCGTATACTATATGGATTAAATGAACAAGGTATGACACCGGATAAATCATATAAAAAATCAGCACGTATCGTTGGTGACGTAATGGGTAAATATCACCCTCATGGTGACTCATCTATTTATGAAGCAATGGTACGTATGGCTCAAGATTTCAGTTATCGTTATCCGCTTGTTGATGGCCAAGGTAACTTTGGTTCAATGGATGGAGATGGCGCAGCAGCAATGCGTTATACTGAAGCGCGTATGACTAAAATCACACTTGAACTGTTACGTGATATTAATAAAGATACAATAGATTTTATCGATAACTATGATGGTAATGAAAGAGAGCCGTCAGTCTTACCTGCTCGATTCCCTAACTTATTAGCCAATGGTGCATCAGGTATCGCGGTAGGTATGGCAACGAATATTCCACCACATAACTTAACAGAATTAATCAATGGTGTACTTAGCTTAAGTAAGAACCCTGATATTTCAATTGCTGAGTTAATGGAGGATATTGAAGGTCCTGATTTCCCAACTGCTGGACTTATTTTAGGTAAGAGTGGTATTAGACGTGCATATGAAACAGGTCGTGGTTCAATTCAAATGCGTTCTCGTGCAGTTATTGAAGAACGTGGAGGCGGACGTCAACGTATTGTTGTCACTGAAATTCCTTTCCAAGTGAATAAGGCTCGTATGATTGAAAAAATTGCAGAGCTCGTTCGTGACAAGAAAATTGACGGTATCACTGATTTACGTGATGAAACAAGTTTACGTACTGGTGTGCGTGTCGTTATTGATGTGCGTAAGGATGCAAATGCTAGTGTCATTTTAAATAACTTATACAAACAAACACCTCTTCAAACATCATTTGGTGTGAATATGATTGCACTTGTAAATGGTAGACCGAAGCTTATTAATTTAAAAGAAGCGTTGGTACATTATTTAGAGCATCAAAAGACAGTTGTTAGAAGACGTACGCAATACAACTTACGTAAAGCTAAAGATCGTGCCCACATTTTAGAAGGATTACGTATCGCACTTGACCATATCGATGAAATTATTTCAACGATTCGTGAGTCAGATACAGATAAAGTTGCAATGGAAAGCTTGCAACAACGCTTCAAACTTTCTGAAAAACAAGCTCAAGCTATTTTAGACATGCGTTTAAGACGTCTAACAGGTTTAGAGAGAGACAAAATTGAAGCTGAATATAATGAGTTATTAAATTATATTAGTGAATTAGAAGCAATCTTAGCTGATGAAGAAGTGTTATTACAGTTAGTTAGAGATGAATTGACTGAAATTAGAGATCGTTTCGGTGATGATCGTCGTACAGAAATTCAATTAGGTGGATTTGAAAACTTAGAGGACGAAGACTTAATTCCAGAAGAACAAATAGTAATTACACTAAGCCATAATAACTACATTAAACGTTTGCCGGTATCTACATATCGTGCTCAAAACCGTGGTGGTCGTGGTGTTCAAGGTATGAATACATTGGAAGAAGATTTTGTCAGTCAATTGGTAACTTTAAGTACACATGACCATGTATTGTTCTTTACTAACAAAGGTCGTGTATACAAACTTAAAGGTTACGAAGTGCCTGAGTTATCAAGACAGTCTAAAGGTATTCCTGTAGTGAATGCTATTGAACTTGAAAATGATGAAGTCATTAGTACAATGATTGCTGTTAAAGACCTTGAAAGTGAAGACAACTTCTTAGTGTTTGCAACTAAACGTGGTGTCGTTAAACGTTCAGCATTAAGTAACTTCTCAAGAATAAATAGAAATGGTAAGATTGCGATTTCGTTCAGAGAAGATGATGAGTTAATTGCAGTTCGCTTAACAAGTGGTCAAGAAGATATCTTGATTGGTACATCACATGCATCATTAATTCGATTCCCTGAATCAACATTACGTCCTTTAGGCCGTACAGCAACGGGTGTGAAAGGTATTACACTTCGTGAAGGTGACGAAGTTGTAGGGCTTGATGTAGCTCATGCAAACAGTGTTGATGAAGTATTAGTAGTTACTGAAAATGGTTATGGTAAACGTACGCCAGTTAATGACTATCGCTTATCAAATCGTGGTGGTAAAGGTATTAAAACAGCTACGATTACTGAGCGTAATGGTAATGTTGTATGTATCACTACAGTAACTGGTGAAGAAGATTTAATGATTGTTACTAATGCAGGTGTCATTATTCGACTAGATGTTGCAGATATTTCTCAAAATGGTCGTGCAGCACAAGGTGTTCGCTTAATTCGCTTAGGTGATGATCAATTTGTTTCAACGGTTGCTAAAGTAAAAGAAGATGCAGAAGATGAAACGAATGAAGATGAGCAATCTACTTCAACTGTATCTGAAGATGGTACTGAACAACAACGTGAAGCGGTTGTAAATGATGAAACACCAGGAAATGCAATTCATACTGAAGTGATTGATTCAGAAGAAAATGATGAAGATGGACGTATTGAAGTAAGACAAGATTTCATGGATCGTGTTGAAGAAGATATACAACAATCATCAGATGAAGAATAA
DNA gyrase subunit A8874.7979899349.3-0.4491545.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, A subunitTIGR010631210.8PF00521DNA_topoisoIVDNA gyrase/topoisomerase IV, subunit Ano clan definedno clan defined529.8
SACOL_RS07385
Cytoplasmicno predicted signal peptide0446741832WP_000819088
MAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELEAILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLGGFENLEDEDLIPEEQIVITLSHNNYIKRLPVSTYRAQNRGGRGVQGMNTLEEDFVSQLVTLSTHDHVLFFTNKGRVYKLKGYEVPELSRQSKGIPVVNAIELENDEVISTMIAVKDLESEDNFLVFATKRGVVKRSALSNFSRINRNGKIAISFREDDELIAVRLTSGQEDILIGTSHASLIRFPESTLRPLGRTATGVKGITLREGDEVVGLDVAHANSVDEVLVVTENGYGKRTPVNDYRLSNRGGKGIKTATITERNGNVVCITTVTGEEDLMIVTNAGVIIRLDVADISQNGRAAQGVRLIRLGDDQFVSTVAKVKEDAEDETNEDEQSTSTVSEDGTEQQREAVVNDETPGNAIHTEVIDSEENDEDGRIEVRQDFMDRVEEDIQQSSDEE
no data available 21166474
SACOL_RS00055SACOL0007S. aureus COLSAUPAN000013000nnrDCDSSACOL_RS00055NAD(P)H-hydrate dehydratasechromosome-978210594813unknownWP_000449218
ATGGAAACGTTAAATTCTATTAACATTCCTAAGCGTAAAGAAGATTCACATAAAGGTGATTATGGCAAAATTTTATTAATTGGTGGATCTGCTAACTTAGGTGGTGCCATTATGTTAGCGGCTCGTGCATGTGTATTTAGCGGTAGTGGTTTAATCACTGTAGCTACACATCCAACAAATCATTCAGCATTACATTCTCGTTGCCCAGAAGCGATGGTTATTGATATTAATGATACGAAAATGTTGACGAAAATGATTGAAATGACTGACAGTATACTAATTGGTCCAGGTCTTGGCGTTGATTTCAAAGGAAATAATGCCATTACATTCCTACTACAAAATATACAACCGCATCAAAATTTAATCGTAGACGGCGATGCGATTACAATCTTTAGTAAACTGAAACCGCAATTACCTACATGTCGTGTGATCTTTACACCACACCTCAAAGAATGGGAACGATTAAGTGGTATTCCTATTGAGGAACAGACATATGAGCGTAATCGTGAAGCAGTTGATCGTTTAGGTGCAACTGTTGTACTTAAAAAACATGGTACTGAAATTTTCTTTAAAGATGAAGACTTTAAATTGACAATCGGTAGCCCAGCAATGGCGACTGGTGGTATGGGCGATACACTTGCTGGTATGATTACAAGCTTTGTCGGTCAATTTGATAACTTAAAAGAAGCGGTTATGAGTGCCACATATACACATAGTTTTATTGGCGAAAACCTTGCAAAAGATATGTATGTGGTGCCACCATCAAGACTTATCAATGAAATACCTTACGCAATGAAACAATTAGAAAGTTAG
NAD(P)H-hydrate dehydratase2706.512229549-0.05259264.2.1.136Unknown functionGeneralYjeF family C-terminal domainTIGR00196185.2PF01256Carb_kinaseCarbohydrate kinaseCL0118Ribokinase194.5no significant predictionno predicted signal peptide1446371363WP_000449218
METLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIMLAARACVFSGSGLITVATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQNIQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDRLGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSATYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
no data available
SACOL_RS00060SACOL0008S. aureus COLSAUPAN000014000hutHCDSSACOL_RS00060histidine ammonia-lyasechromosome+10920124341515unknownWP_000177464
ATGACTTTATATTTAGATGGTGAAACACTAACAATTGAGGATATTAAATCATTTTTACAACAACAATCAAAGATTGAAATTATTGATGATGCGTTAGAACGTGTCAAAAAAAGTAGAGCGGTAGTTGAACGTATTATTGAAAATGAGGAAACGGTTTACGGTATTACTACAGGTTTTGGGTTATTTAGTGATGTACGTATAGACCCGACGCAATATAATGAATTACAAGTGAATCTGATACGCTCACATGCCTGTGGACTAGGTGAGCCATTTTCAAAAGAAGTAGCATTAGTCATGATGATTTTACGATTGAATACATTATTAAAAGGTCATTCAGGTGCCACTTTAGAATTAGTGAGACAATTACAATTTTTTATAAATGAACGTATTATACCGATAATCCCACAGCAAGGCTCTCTCGGTGCATCAGGAGATTTAGCGCCATTATCACATTTAGCATTAGCATTAATTGGTGAAGGGAAAGTATTGTACAGAGGGGAAGAAAAGGATAGTGACGATGTATTAAGAGAATTAAATAGACAACCTTTGAACCTTCAGGCTAAAGAAGGTTTAGCATTGATTAATGGTACGCAAGCTATGACAGCTCAAGGTGTCATTAGTTATATAGAAGCAGAAGATTTAGGTTACCAATCTGAATGGATTGCTGCATTAACGCATCAGTCTCTTAATGGCATTATAGATGCATATCGACATGATGTGCACGCAGTTCGTAATTTTCAAGAACAGATTAATGTGGCAGCGCGTATGCGTGATTGGTTAGAAGGATCAACATTAACGACGCGACAATCAGAAATACGTGTACAAGATGCATATACGTTGCGTTGTATACCACAAATCCATGGCGCGAGTTTTCAAGTATTCAATTATGTTAAACAGCAATTAGAATTTGAAATGAATGCGGCTAATGATAATCCACTTATATTTGAGGAAGCAAATGAAACGTTTGTTATTTCAGGTGGTAACTTCCATGGACAACCTATTGCTTTTGCATTAGATCATCTTAAATTAGGTGTAAGTGAATTAGCAAACGTATCGGAACGTCGTCTAGAGCGACTAGTAAATCCTCAATTAAATGGTGATTTACCAGCATTTCTTAGTCCAGAGCCAGGATTGCAAAGTGGCGCGATGATTATGCAATATGCTGCTGCAAGTCTCGTTTCTGAAAATAAAACTTTAGCGCATCCAGCGAGTGTTGATTCTATCACTTCATCTGCGAACCAAGAAGATCACGTATCTATGGGAACTACAGCTGCTAGACATGGTTATCAAATTATTGAAAATGCAAGACGTGTGCTGGCAATCGAATGTGTTATTGCATTACAAGCAGCAGAGTTAAAAGGTGTTGAAGGATTATCACCAAAAACACGTCGCAAGTATGATGAGTTTCGAAGTATCGTGCCATCCATTACACATGATCGTCAATTTCATAAAGATATTGAAGCGGTTGCACAGTATTTAAAGCAATCAATTTATCAAACGACTGCATGTCACTAA
histidine ammonia-lyase5045.1467156075.2-0.1857144.3.1.3MetabolismEnergy metabolismAmino acids and amineshistidine ammonia-lyaseTIGR01225665PF00221Lyase_aromaticAromatic amino acid lyaseno clan definedno clan defined612.4Cytoplasmicno predicted signal peptide0446099609WP_000177464
MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERIIENEETVYGITTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRLNTLLKGHSGATLELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVLYRGEEKDSDDVLRELNRQPLNLQAKEGLALINGTQAMTAQGVISYIEAEDLGYQSEWIAALTHQSLNGIIDAYRHDVHAVRNFQEQINVAARMRDWLEGSTLTTRQSEIRVQDAYTLRCIPQIHGASFQVFNYVKQQLEFEMNAANDNPLIFEEANETFVISGGNFHGQPIAFALDHLKLGVSELANVSERRLERLVNPQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTLAHPASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKGVEGLSPKTRRKYDEFRSIVPSITHDRQFHKDIEAVAQYLKQSIYQTTACH
no data available
SACOL_RS14345S. aureus COLCDSSACOL_RS14345hypothetical proteinchromosome-1263512823189unknownWP_001803754
ATGTCTAACATTAACCTTCATCCTTTCCCAAATAATTATCATTTATTATGGAATGACGTACGTCTTTATTTTTTAGAAAATAAAAAAAGACCACATCCCTACAAGGGACGTGGTCTACGCGTTGCCACCCTATTTAACAATTTAAGTTATAAAGATACACTAAACCTAAATTGCACTTCACTAAAATAA
hypothetical protein6210.37987404.49-0.662903no significant predictionno predicted signal peptide0WP_001803754
MSNINLHPFPNNYHLLWNDVRLYFLENKKRPHPYKGRGLRVATLFNNLSYKDTLNLNCTSLK
no data available
SACOL_RS00065SACOL0009S. aureus COLSAUPAN000017000serSCDSSACOL_RS00065serine--tRNA ligasechromosome+12813140991287unknownWP_000884334
ATGTTAGACATTAGATTATTCAGAAATGAGCCTGACACAGTTAAGAGCAAAATTGAATTACGTGGAGATGATCCAAAAGTTGTAGATGAAATTTTAGAATTGGATGAGCAACGACGTAAATTAATTAGTGCAACAGAAGAAATGAAAGCACGTCGTAATAAAGTAAGCGAAGAAATCGCATTAAAAAAACGTAATAAAGAAAATGCTGATGATGTGATTGCTGAAATGCGCACATTAGGTGACGATATTAAAGAAAAAGATAGTCAATTAAATGAAATTGATAATAAAATGACAGGTATCCTTTGTCGTATTCCAAATTTAATAAGTGATGATGTACCTCAAGGTGAATCTGATGAAGATAACGTTGAAGTTAAAAAGTGGGGTACACCACGTGAGTTTTCATTTGAACCCAAAGCACATTGGGATATTGTAGAAGAATTGAAAATGGCTGATTTTGATCGTGCAGCAAAAGTTTCAGGTGCGCGTTTTGTATATTTAACAAATGAAGGTGCGCAATTAGAGCGTGCTTTAATGAACTATATGATTACAAAACATACAACACAACATGGTTATACAGAAATGATGGTACCACAGCTTGTGAACGCAGATACAATGTATGGTACAGGTCAATTACCTAAATTTGAAGAAGATTTATTTAAAGTAGAAAAAGAAGGATTATATACAATTCCAACTGCTGAAGTACCATTAACGAATTTCTACCGTAATGAAATTATTCAACCAGGTGTACTTCCTGAAAAATTCACTGGTCAATCTGCATGTTTCCGTAGTGAAGCAGGATCAGCAGGTAGAGATACAAGAGGATTAATTCGTTTACATCAATTCGATAAAGTGGAAATGGTACGTTTTGAACAACCTGAAGATTCATGGAATGCTTTAGAAGAAATGACAACAAACGCAGAAGCAATTCTAGAAGAGTTAGGTTTACCATACCGTCGTGTTATTTTATGTACAGGTGATATTGGATTTAGTGCAAGCAAAACATATGATTTAGAAGTTTGGTTACCAAGCTACAATGATTATAAAGAAATTAGTTCATGCTCAAACTGTACGGATTTCCAAGCGCGTCGTGCTAACATCCGCTTCAAGCGTGACAAAGCAGCTAAACCAGAATTAGCACATACATTAAATGGTAGTGGTTTAGCAGTTGGACGTACATTTGCTGCTATTGTTGAAAATTACCAAAATGAAGATGGAACAGTAACAATTCCAGAAGCATTAGTACCATTTATGGGTGGTAAAACACAAATTTCAAAACCAGTTAAATAA
serine--tRNA ligase4284.7466548639.7-0.5866826.1.1.11Genetic information processingProtein synthesistRNA aminoacylationserine--tRNA ligaseTIGR00414571.6PF00587tRNA-synt_2btRNA synthetase class II core domain (G, H, P, S and T)CL0040tRNA_synt_II114.8
SACOL_RS03075; SACOL_RS03080; SACOL_RS04310; SACOL_RS05630; SACOL_RS05635; SACOL_RS05640; SACOL_RS05645; SACOL_RS06505; SACOL_RS07390; SACOL_RS08345; SACOL_RS08795; SACOL_RS08930; SACOL_RS08970; SACOL_RS11435; SACOL_RS11765; SACOL_RS13915
Cytoplasmicno predicted signal peptide0446807078WP_000884334
MLDIRLFRNEPDTVKSKIELRGDDPKVVDEILELDEQRRKLISATEEMKARRNKVSEEIALKKRNKENADDVIAEMRTLGDDIKEKDSQLNEIDNKMTGILCRIPNLISDDVPQGESDEDNVEVKKWGTPREFSFEPKAHWDIVEELKMADFDRAAKVSGARFVYLTNEGAQLERALMNYMITKHTTQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVEKEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRDTRGLIRLHQFDKVEMVRFEQPEDSWNALEEMTTNAEAILEELGLPYRRVILCTGDIGFSASKTYDLEVWLPSYNDYKEISSCSNCTDFQARRANIRFKRDKAAKPELAHTLNGSGLAVGRTFAAIVENYQNEDGTVTIPEALVPFMGGKTQISKPVK
no data available 21166474
SACOL_RS00070SACOL0010S. aureus COLSAUPAN000018000-CDSSACOL_RS00070branched-chain amino acid ABC transporter permeasechromosome+1474915444696unknownWP_000207095
ATGACAACACATTTAAGTTTTAGACAAGGCGTGCAAGAGTGTATCCTAACATTATTGGGTTATGCCGGTGTTGGTATTTCATTTGGTATTGTGGCTTCGTCTCAAAACTTTAGTATTTTAGAAATTGTCTTGTTATGTCTTGTTATATATGCCGGTGCTGCGCAATTTATTATGTGCGCGTTGTTTATAGCAGGTACACCTATATCAGCGATTGTACTAACTGTATTTATCGTAAATTCAAGAATGTTCCTTTTAAGTATGTCGCTTGCACCAAACTTCAAGACATATGGGTTTTGGAACCGTGTTGGATTAGGTTCATTAGTAACTGACGAAACGTTTGGCGTCGCCATTACACCTTATTTAAAAGGAGAAGCTATCAATGATCGTTGGATGCATGGTCTTAACATCACAGCATATTTATTTTGGGCAATTTCATGTGTAGCTGGGGCTTTATTTGGCGAATATATCTCAAATCCGCAAACGCTAGGGTTAGATTTTGCTATCACGGCTATGTTTATCTTTTTGGCCATTGCGCAATTTGAATCAATTACTAAATCGCGATTAAGAATTTACATAGTACTCATTATTGCCGTCATAGTAATGATGTTATCGCTAAGTATGTTTATGCCTTCATATCTAGCAATATTAATTGCAGCCACAATTTCAGCAGCGTTAGGAGTGATGATGGAACAATGA
branched-chain amino acid ABC transporter permease2316.49023251631.07186MetabolismTransport and binding proteinsAmino acids, peptides and aminesazaleucine resistance protein AzlCTIGR0034685.5PF03591AzlCAzlC proteinno clan definedno clan defined126.3Cytoplasmic Membraneno predicted signal peptide7446129240WP_000207095
MTTHLSFRQGVQECILTLLGYAGVGISFGIVASSQNFSILEIVLLCLVIYAGAAQFIMCALFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPYLKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQFESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMEQ
no data available
SACOL_RS00075SACOL0011S. aureus COLSAUPAN000019000-CDSSACOL_RS00075membrane proteinchromosome+1544115770330unknownWP_000628050
ATGATAACTCATATGAACATGTTAATACTTATTTTATTGTGTGGTATCGTAACGCTATTAATTCGAATTATACCTTTTATCATGATTTCAAAAGTGCAATTGCCTGATGTCGTGGTTCGATGGCTATCATTTATCCCAATCACACTATTTACGGCACTTGTCATTGACAGCATTATTCAACAGACGCCTCATGGTGAGGGGTATACATTAAACATCCCTTACATTATCGCGCTCATTCCGACGGTTATTTTATCTATAATCACGCGTAGTTTAACTATTACAATTATTAGTGGGATTGTTATCATGGCAGCATTACGATTTTTCTTTTAA
membrane protein1099.2996112233.11.47523Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein FTIGR021209.3PF05437AzlDBranched-chain amino acid transport protein (AzlD)no clan definedno clan defined83.4Cytoplasmic Membraneno predicted signal peptide4446550704WP_000628050
MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQQTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAALRFFF
no data available
SACOL_RS00080SACOL0012S. aureus COLSAUPAN000021000metXCDSSACOL_RS00080homoserine O-acetyltransferasechromosome+1613317101969unknownWP_000186481
ATGACAAATTACACAGTAGATACTTTAAATTTAGGGGAATTTATTACAGAATCTGGGGAAGTCATAGATAACTTGCGTTTGAGATATGAGCATGTCGGTTATCATGGACAACCATTAGTTGTAGTTTGTCATGCATTAACTGGCAATCATTTAACATATGGAACAGATGATTATCCGGGTTGGTGGCGAGAAATTATTGATGGGGGATATATACCCATTCACGATTATCAATTTTTAACATTTGATGTTATTGGTAGTCCTTTCGGTTCAAGTTCACCTTTAAACGACCCTCATTTTCCTAAAAAATTAACATTAAGAGATATAGTCAGAGCGAATGAACGAGGTATACAAGCCCTTGGTTATGATAAGATTAATATTTTAATAGGGGGAAGTCTTGGAGGTATGCAAGCAATGGAACTACTCTACAATCAACAGTTTGAAGTAGATAAAGCCATTATCCTTGCTGCAACAAGTCGAACATCATCTTATAGTAGAGCTTTCAATGAAATTGCAAGGCAAGCCATTCATCTTGGTGGTAAGGAAGGTCTAAGTATTGCACGCCAATTAGGTTTTTTGACATATCGATCATCAAAAAGTTATGATGAACGTTTCACGCCGGATGAAGTAGTCGCATACCAACAACATCAAGGTAATAAATTTAAAGAACATTTTGATTTGAATTGTTATCTGACACTGCTAGATGTATTGGATAGTCACAACATTGACCGAGGTCGCACAGACGTAACGCATGTTTTTAAAAATTTAGAAACAAAAGTGTTAACGATGGGGTTCATAGATGATTTGCTATATCCGGATGATCAAGTTCGTGCATTAGGTGAACGTTTTAAATATCATCGTCATTTCTTCGTGCCTGATAATGTTGGGCATGATGGATTCCTACTAAACTTTAGTACCTGGGCACCTAACTTATATCATTTCTTAAATTTAAAGCATTTTAAGCGTAAGTAA
homoserine O-acetyltransferase3226.614736927.4-0.349068MetabolismAmino acid biosynthesisAspartate familyhomoserine O-acetyltransferaseTIGR01392202PF00561Abhydrolase_1alpha/beta hydrolase foldCL0028AB_hydrolase59.4Cytoplasmicno predicted signal peptide0446108626WP_000186481
MTNYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRK
no data available
SACOL_RS00085SACOL0013S. aureus COLSAUPAN000023000-CDSSACOL_RS00085membrane proteinchromosome+1739218330939unknownWP_001791710
ATGGGAGTGGCTTATGTGTTTTCAAAAATACAACCTAAAGCAACAATAATTGCAACGATTGCGTTGGTATTTGTCGCTTTAGCTTTATATCTAGTGCCTGGTTTAGGACTAATATTTGCATTATTTGCAACCATACCAGGTATCGTTTTATGGAATAAATCAATACAATCTTTCGGGATTAGTGCACTTATTACAGTAATTATAACAACTGTTTTAGGTAATACTTTCGTTTTAAGTGCCATCATATTAGTCTTAATTGCAAGTTTAATTATTGGTCAATTGCTCAAAGAAAGAACGTCTAAAGAAAGAATATTATACGTAACAACAGTAGCGATGAGCTTAATTTCATTAATCGCTTTTATGTTACTACAAACATTCGGAAGGATTCCACCATCAGCGAGCATAGTAAAACCTTTCAAGCAAACATTACATGAAGCGATTACGATGAGCGGTGCCGATGCGAATATGACCCAAATATTAGAAGAAGGGTTTAGACAAGCGACCGTTCAATTACCAGGTTTCATCATTATCATTACATTTTTAATCGTCTTAATTAACTTAATCGTTACATTTCCGATTTTACGAAAATTTAAAATCGCTACACCTGTATTTAAGCCACTTTTCGCGTGGCAAATGAGCGGTATTTTATTATGGATATACATTATTGTTATCATATGTTTATTATTTACAGGTCAACCGAGTGTGTTCCAGAGCATTCTTTTAAACTTCCAACTTGTGTTATCATTAGTAATGTATATTCAAGGTTTAAGTGTTATTCATTTCTTTGGTAAAGCGAAAGGTTTGCCGAATGCAGTAACGATTTTACTATTGGTTATCGGTACAATACTGACACCTACGACACATATTGTAGGACTACTTGGTGTTATCGATTTAAGTTTGAATTTGAAGCGAATCATGAAAAATAATTCTAAAAAGTGA
membrane protein31210.865834148.51.14551PF09991DUF2232Predicted membrane protein (DUF2232)no clan definedno clan defined212.7Cytoplasmic Membraneno predicted signal peptide7487707478WP_001791710
MGVAYVFSKIQPKATIIATIALVFVALALYLVPGLGLIFALFATIPGIVLWNKSIQSFGISALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSKERILYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILEEGFRQATVQLPGFIIIITFLIVLINLIVTFPILRKFKIATPVFKPLFAWQMSGILLWIYIIVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLVIGTILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
no data available
SACOL_RS00090SACOL0014S. aureus COLSAUPAN000024000-CDSSACOL_RS00090DHH family phosphoesterasechromosome+18345203121968unknownWP_001081634
ATGAATCGGCAGTCCACTAAGAAAGCTTTACTAATACCATTTGTCATCATGATCATCACAGCAATTGTTTTAATGGGTGTATGGTTTATCTTTAATAGTCTTATAGCACTAATTGCATCTATCGTTCTTGTCGTGATGATTATTGTTAGCATCATTTTATTCAGACAAGCTTTAATGAAAATGGATAGTTATGTAGATGGTTTGAGTGCTCAAATTTCAACAACAAATAATAAAGCAATCAAACATTTACCAATTGGTATCATTGTTTTAGATGAAAATGATCACATCGAATGGGTTAACCAATTTATGACAGATCATATGGAAGCGAATGTCATTTCTGAATCTGTAAATGAAGTATTTCCAAACATTTTAAAGCAATTAGATAGAGTGAAATCCGTTGAAATAGAATATAATCAGTATCATTTCCAAGTACGTTATTCTGAGAATGATCACTGCCTCTATTTCTTTGATATAACTGAACAAGTACAAACAAATGAACTATATGAAAATTCTAAACCAATCATTGCGACATTATTTTTAGATAACTACGATGAGATTACGCAAAATATGAATGATACGCAGCGTTCGGAAATCAACTCAATGGTAACGCGTGTCATTAGTCGATGGGCAACTGAGTATAATATATTTTTCAAAAGATACAGTTCCGATCAATTCGTAGCCTATTTAAATCAAAAAATATTAGCTGACTTAGAAGAATCTAAATTTGATATCTTGAGTCAATTACGTGAAAAAAGTGTTGGTTATCGTGCCCAATTAACATTAAGTATCGGTGTTGGTGAAGGTACTGAAAATTTAATCGACTTAGGTGAATTATCACAATCAGGCCTAGACTTAGCATTAGGACGCGGTGGCGACCAAGTTGCAATTAAAAGTATTAATGGTAATGTGCGTTTCTATGGCGGTAAGACTGACCCGATGGAGAAACGTACTCGTGTAAGAGCACGTGTGATCTCACATGCGTTAAAAGATATCCTTGCAGAGGGTGACAAAGTCATTATCATGGGACATAAACGTCCTGACTTAGATGCAATTGGTGCAGCAATCGGTGTGTCTAGATTTGCAATGATGAATAATTTAGAAGCATACATCGTATTAAATGAGACTGACATTGATCCAACATTACGACGCGTGATGAACGAAATAGATAAAAAGCCAGAGTTAAGAGAGCGATTTATTACATCAGATGATGCTTGGGATATGATGACATCTAAGACAACCGTAGTGATTGTTGATACGCATAAACCGGAACTGGTTTTAGATGAAAATGTCTTAAATAAAGCAAACCGTAAAGTTGTTATCGATCATCATAGACGTGGTGAAAGCTTCATCTCTAATCCATTGTTGATATATATGGAACCATACGCAAGTTCGACAGCTGAATTGGTAACAGAGTTACTGGAATATCAACCAACAGAACAACGTTTAACACGTCTTGAATCAACAGTGATGTATGCAGGTATTATTGTAGATACAAGAAACTTTACATTACGAACAGGATCAAGAACATTCGATGCAGCGAGTTATTTACGTGCACATGGTGCAGATACGATTTTAACGCAACATTTCTTAAAAGATGATGTGGATACTTACATTAATCGATCTGAATTAATTCGAACTGTAAAAGTTGAAGATAATGGCATAGCCATTGCGCATGGTTCAGACGATAAAATTTATCATCCAGTAACAGTTGCACAAGCAGCAGATGAACTGTTAAGTTTAGAAGGTATTGAAGCATCATATGTTGTTGCGAGACGTGAAGATAATCTGATTGGTATATCTGCGCGTTCACTCGGTTCAGTAAATGTCCAGTTAACAATGGAAGCACTTGGTGGCGGTGGACATTTAACCAATGCGGCAACACAACTTAAAGGTGTGACAGTCGAAGAGGCGATAGCACAATTACAACAAGCAATTACAGAACAATTAAGTAGGAGTGAAGATGCATGA
DHH family phosphoesterase6554.9008373780.7-0.110229Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR0296617.5PF01368DHHDHH familyCL0137HAD79.2Cytoplasmicno predicted signal peptide2447004378WP_001081634
MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMKMDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTDHMEANVISESVNEVFPNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFLDNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEESKFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSINGNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRFAMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFITSDDAWDMMTSKTTVVIVDTHKPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQRLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINRSELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGISARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
no data available
SACOL_RS00095SACOL0015S. aureus COLSAUPAN000025000rplICDSSACOL_RS0009550S ribosomal protein L9chromosome+2030920755447unknownWP_000864305
ATGAAAGTAATTTTTACACAAGATGTTAAAGGTAAAGGTAAAAAAGGTGAAGTTAAAGAAGTACCAGTAGGTTATGCAAATAACTTCTTATTGAAAAAGAATTATGCTGTAGAAGCAACACCAGGTAACCTTAAACAATTAGAGTTACAGAAAAAACGTGCAAAACAAGAACGCCAACAAGAAATTGAAGATGCTAAAGCATTAAAAGAAACGTTATCAAACATTGAAGTTGAAGTATCAGCAAAAACTGGTGAAGGTGGTAAATTGTTTGGGTCAGTAAGTACAAAACAAATTGCCGAAGCACTAAAAGCACAACATGATATTAAAATTGATAAACGTAAAATGGATTTACCAAATGGAATTCATTCCCTAGGATATACGAATGTACCTGTTAAATTAGATAAAGAAGTTGAAGGTACAATTCGCGTACACACAGTTGAACAATAA
50S ribosomal protein L914810.065416453.8-0.681757Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL9TIGR00158149.7PF03948Ribosomal_L9_CRibosomal protein L9, C-terminal domainno clan definedno clan defined98.6
SACOL_RS02555; SACOL_RS03025; SACOL_RS03035; SACOL_RS03755; SACOL_RS08930; SACOL_RS11775
Cytoplasmicno predicted signal peptide0446787049WP_000864305
MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
no data available 21166474
SACOL_RS00100SACOL0016S. aureus COLSAUPAN000026000dnaCCDSSACOL_RS00100replicative DNA helicasechromosome+20787221871401unknownWP_000375647
ATGGATAGAATGTATGAGCAAAATCAAATGCCGCATAACAATGAAGCTGAACAGTCTGTCTTAGGTTCAATTATTATAGATCCAGAATTGATTAATACTACTCAGGAAGTTTTGCTTCCTGAGTCGTTTTATAGGGGTGCCCATCAACATATTTTCCGTGCAATGATGCACTTAAATGAAGATAATAAAGAAATTGATGTTGTAACATTGATGGATCAATTATCGACGGAAGGTACGTTGAATGAAGCGGGTGGCCCGCAATATCTTGCAGAGTTATCTACAAATGTACCAACGACGCGAAATGTTCAGTATTATACTGATATCGTTTCTAAGCATGCATTAAAACGTAGATTGATTCAAACTGCAGATAGTATTGCCAATGATGGATATAATGATGAACTTGAACTAGATGCGATTTTAAGTGATGCAGAACGTCGAATTTTAGAGCTATCATCTTCTCGTGAAAGCGATGGCTTTAAAGACATTCGAGACGTCTTAGGACAAGTGTATGAAACAGCTGAAGAGCTTGATCAAAATAGTGGTCAAACACCAGGTATACCTACAGGATATCGAGATTTAGACCAAATGACAGCAGGGTTCAACCGAAATGATTTAATTATCCTTGCAGCGCGTCCATCTGTAGGTAAGACTGCGTTCGCACTTAATATTGCACAAAAAGTTGCAACGCATGAAGATATGTATACAGTTGGTATTTTCTCGCTAGAGATGGGTGCTGATCAGTTAGCCACACGTATGATTTGTAGTTCTGGAAATGTTGACTCAAACCGCTTAAGAACGGGTACTATGACTGAGGAAGATTGGAGTCGTTTTACTATAGCGGTAGGTAAATTATCACGTACGAAGATTTTTATTGATGATACACCGGGTATTCGAATTAATGATTTACGTTCTAAATGTCGTCGATTAAAGCAAGAACATGGCTTAGACATGATTGTGATTGACTACTTACAGTTGATTCAAGGTAGTGGTTCACGTGCGTCCGATAACAGACAACAGGAAGTTTCTGAAATCTCTCGTACATTAAAAGCATTAGCCCGTGAATTAGAATGTCCAGTTATCGCATTAAGTCAGTTATCTCGTGGTGTTGAACAACGACAAGATAAACGTCCAATGATGAGTGATATTCGTGAATCTGGTTCGATTGAGCAAGATGCCGATATCGTTGCATTCTTATACCGTGATGATTACTATAACCGTGGCGGCGATGAAGATGATGACGATGATGGTGGTTTCGAGCCACAAACGAATGATGAAAACGGTGAAATTGAAATTATCATTGCTAAGCAACGTAACGGTCCAACAGGCACAGTTAAGTTACATTTTATGAAACAATATAATAAATTTACCGATATCGATTATGCACATGCAGATATGATGTAA
replicative DNA helicase4664.4176752571.3-0.5907733.6.1.-; 3.6.4.12Genetic information processingDNA metabolismDNA replication, recombination, and repairreplicative DNA helicaseTIGR00665585.3PF03796DnaB_CDnaB-like helicase C terminal domainCL0023P-loop_NTPase383.9
SACOL_RS03755; SACOL_RS08905; SACOL_RS11695
Cytoplasmicno predicted signal peptide0446297792WP_000375647
MDRMYEQNQMPHNNEAEQSVLGSIIIDPELINTTQEVLLPESFYRGAHQHIFRAMMHLNEDNKEIDVVTLMDQLSTEGTLNEAGGPQYLAELSTNVPTTRNVQYYTDIVSKHALKRRLIQTADSIANDGYNDELELDAILSDAERRILELSSSRESDGFKDIRDVLGQVYETAEELDQNSGQTPGIPTGYRDLDQMTAGFNRNDLIILAARPSVGKTAFALNIAQKVATHEDMYTVGIFSLEMGADQLATRMICSSGNVDSNRLRTGTMTEEDWSRFTIAVGKLSRTKIFIDDTPGIRINDLRSKCRRLKQEHGLDMIVIDYLQLIQGSGSRASDNRQQEVSEISRTLKALARELECPVIALSQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNRGGDEDDDDDGGFEPQTNDENGEIEIIIAKQRNGPTGTVKLHFMKQYNKFTDIDYAHADMM
no data available 21166474
SACOL_RS14350S. aureus COLCDS, pseudogeneSACOL_RS14350hypothetical proteinchromosome-2223722464228unknown
GTGAGCACCTCCAAGTTTTTCTCATTTAACCATTTGATATTCTACCAATATCGAGACCATAATGCAAATAAAAATCGAACATTGATTTTCGGCCTTTTTAAAAGAAAAATCATTTTAACAAATCGTTTTCAACGTCCTTAAAACCCTTTAACAGAGGCGTTGACAGTACTAATTTATCACTTTCAATACACAAACTTAACATATATCAACCCGTTCAGAACAAAATAA
hypothetical protein0no predicted signal peptideno data available
SACOL_RS00105SACOL0018S. aureus COLSAUPAN000028000purACDSSACOL_RS00105adenylosuccinate synthetasechromosome+22465237481284unknownWP_000095327
ATGTCATCAATCGTAGTAGTTGGGACACAATGGGGAGACGAAGGAAAAGGAAAAATAACGGATTTCTTGGCAGAACAGTCAGATGTTATCGCGCGTTTTTCAGGTGGTAATAATGCAGGCCATACCATTCAATTTGGCGGAGAAACATATAAATTACATTTAGTACCATCTGGTATCTTTTACAAAGACAAATTAGCGGTAATCGGTAACGGAGTCGTTGTTGATCCAGTTGCACTATTGAAAGAATTAGACGGATTAAATGAACGTGGCATTCCTACAAGTAATTTACGTATATCTAATCGTGCGCAAGTGATTTTACCATATCACTTAGCACAAGATGAATATGAAGAACGTTTACGTGGTGACAATAAGATTGGTACAACTAAAAAAGGTATCGGTCCAGCATATGTAGACAAAGTTCAACGTATCGGTATTCGTATGGCAGATTTACTTGAAAAAGAAACATTCGAAAGATTATTAAAATCAAACATTGAATATAAACAAGCATATTTCAAAGGTATGTTTAACGAAACATGTCCATCATTTGATGATATCTTTGAAGAATATTATGCAGCAGGTCAACGTCTAAAAGAATTTGTAACAGACACATCAAAAATCTTAGACGATGCATTTGTAGCAGATGAAAAGGTACTTTTCGAAGGTGCGCAAGGTGTAATGTTAGATATCGACCATGGTACATATCCATTCGTTACATCAAGTAATCCAATTGCAGGTAACGTTACTGTTGGTACAGGTGTAGGTCCTACATTCGTTTCAAAGGTAATTGGTGTATGTAAAGCTTATACATCACGTGTTGGTGATGGTCCATTCCCTACTGAATTATTCGATGAAGATGGACATCATATTAGAGAGGTTGGTCGTGAATACGGTACAACAACAGGACGTCCACGTCGTGTAGGTTGGTTTGATTCAGTTGTATTACGTCACTCTCGTCGTGTAAGTGGTATTACAGATTTATCTATTAACTCAATCGATGTTTTAACAGGCCTAGACACAGTGAAAATCTGTACAGCTTATGAATTAGACGGTAAAGAAATTACTGAGTACCCAGCAAACTTAGATCAATTAAAACGTTGTAAACCAATCTTTGAAGAGTTACCAGGTTGGACAGAAGACGTAACAAATGTGCGTACTTTAGAAGAATTACCTGAAAATGCACGTAAATATTTAGAGCGTATTTCAGAATTATGTAATGTACAAATTTCTATCTTCTCAGTTGGTCCAGATAGAGAACAAACAAACCTATTAAAAGAATTGTGGTAG
adenylosuccinate synthetase4274.8564547578.4-0.3065576.3.4.4MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisadenylosuccinate synthaseTIGR00184595PF00709Adenylsucc_syntAdenylosuccinate synthetaseCL0023P-loop_NTPase588.1
SACOL_RS00095; SACOL_RS00470; SACOL_RS01040; SACOL_RS02200; SACOL_RS02210; SACOL_RS02285; SACOL_RS02315; SACOL_RS02330; SACOL_RS02850; SACOL_RS02930; SACOL_RS03025; SACOL_RS03030; SACOL_RS03035; SACOL_RS03040; SACOL_RS03055; SACOL_RS03065; SACOL_RS03070; SACOL_RS03075; SACOL_RS03080; SACOL_RS03275; SACOL_RS03540; SACOL_RS04190; SACOL_RS04310; SACOL_RS04315; SACOL_RS04320; SACOL_RS04330; SACOL_RS04495; SACOL_RS04690; SACOL_RS04840; SACOL_RS04925; SACOL_RS04950; SACOL_RS04980; SACOL_RS05185; SACOL_RS05205; SACOL_RS05570; SACOL_RS05575; SACOL_RS05630; SACOL_RS05640; SACOL_RS05645; SACOL_RS05900; SACOL_RS06140; SACOL_RS06375; SACOL_RS06405; SACOL_RS06420; SACOL_RS06505; SACOL_RS06515; SACOL_RS06595; SACOL_RS06770; SACOL_RS06965; SACOL_RS07010; SACOL_RS07050; SACOL_RS07385; SACOL_RS07440; SACOL_RS07680; SACOL_RS07705; SACOL_RS07720; SACOL_RS07920; SACOL_RS08210; SACOL_RS08345; SACOL_RS08670; SACOL_RS08680; SACOL_RS08795; SACOL_RS08820; SACOL_RS08830; SACOL_RS08865; SACOL_RS08905; SACOL_RS08930; SACOL_RS08935; SACO
Cytoplasmicno predicted signal peptide0446017472WP_000095327
MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTNVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELW
no data available 21166474
SACOL_RS00110SACOL_tRNA-Glu-1S. aureus COLSAUPAN000029000trnaEtRNASACOL_RS00110tRNA-Gluchromosome+241782425275unknown
GGCTCCTTGGTCAAGCGGTTAAGACACCGCCCTTTCACGGCGGTAACACGGGTTCGAGTCCCGTAGGAGTCACCA
tRNA-Glu0no predicted signal peptideno data available
SACOL_RS00115SACOL_tRNA-Asp-1S. aureus COLSAUPAN000030000trnaDtRNASACOL_RS00115tRNA-Aspchromosome+242602433273unknown
GGTCTCGTAGTGTAGCGGTTAACACGCCTGCCTGTCACGCAGGAGATCGCGGGTTCGATTCCCGTCGAGACCG
tRNA-Asp0no predicted signal peptideno data available
SACOL_RS00120SACOL0019S. aureus COLSAUPAN000032000walRCDSSACOL_RS00120DNA-binding response regulatorchromosome+2495225653702unknownWP_000101976
ATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTTAACTTAAAAAAAGAAGGATACGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGACTTAATTTATGAAGAAGAACCAGACATCGTATTACTAGATATCATGTTACCTGGTCGTGATGGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATAATAATGCTTACTGCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTAACGAAACCGTTTAGTACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCATTACTCACAACCAGCACAAGACACTGGAAATGTAACGAATGAAATCACAATTAAAGATATTGTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTAACACATCGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAACATTTATTACAAACAGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTAACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGTCACATCCTGAATATATTGTGACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG
DNA-binding response regulator2334.8121127191.8-0.475536Signal transductionRegulatory functions; Signal transductionDNA interactions; Two-component systemsphosphate regulon transcriptional regulatory protein PhoBTIGR02154235.8PF00072Response_regResponse regulator receiver domainCL0304CheY103.1
SACOL_RS02555; SACOL_RS02850; SACOL_RS05640; SACOL_RS06505; SACOL_RS07720; SACOL_RS11010; SACOL_RS11750; SACOL_RS13725
Cytoplasmicno predicted signal peptide0446024121WP_000101976
MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
no data available 21166474
SACOL_RS00125SACOL0020S. aureus COLSAUPAN000033000walKCDSSACOL_RS00125cell wall metabolism sensor histidine kinase WalKchromosome+25666274921827unknownWP_000871607
ATGAAGTGGCTAAAACAACTACAATCCCTTCATACTAAACTTGTAATTGTTTATGTATTACTGATTATCATTGGTATGCAAATTATCGGGTTATATTTTACAAATAACCTTGAAAAAGAGCTGCTTGATAATTTTAAGAAGAATATTACGCAGTACGCGAAACAATTAGAAATTAGTATTGAAAAAGTATATGACGAAAAGGGCTCCGTAAATGCACAAAAAGATATTCAAAATTTATTAAGTGAGTATGCCAACCGTCAAGAAATTGGAGAAATTCGTTTTATAGATAAAGACCAAATTATTATTGCGACGACGAAGCAGTCTAACCGTAGTCTAATCAATCAAAAAGCGAATGATAGTTCTGTCCAAAAAGCACTATCACTAGGACAATCAAACGATCATTTAATTTTAAAAGATTATGGCGGTGGTAAGGACCGTGTCTGGGTATATAATATCCCAGTTAAAGTCGATAAAAAGGTAATTGGTAATATTTATATCGAATCAAAAATTAATGACGTTTATAACCAATTAAATAATATAAATCAAATATTCATTGTTGGTACAGCTATTTCATTATTAATCACAGTCATCCTAGGATTCTTTATAGCGCGAACGATTACCAAACCAATCACCGATATGCGTAACCAGACGGTCGAAATGTCCAGAGGTAACTATACGCAACGTGTGAAGATTTATGGTAATGATGAAATTGGCGAATTAGCTTTAGCATTTAATAACTTGTCTAAACGTGTACAAGAAGCGCAGGCTAATACTGAAAGTGAGAAACGTAGACTGGACTCAGTTATCACCCATATGAGTGATGGTATTATTGCAACAGACCGCCGTGGACGTATTCGTATCGTCAATGATATGGCACTCAAGATGCTTGGTATGGCGAAAGAAGACATCATCGGATATTACATGTTAAGTGTATTAAGTCTTGAAGATGAATTTAAACTGGAAGAAATTCAAGAGAATAATGATAGTTTCTTATTAGATTTAAATGAAGAAGAAGGTCTAATCGCACGTGTTAACTTTAGTACGATTGTGCAGGAAACAGGATTTGTAACTGGTTATATCGCTGTGTTACATGACGTAACTGAACAACAACAAGTTGAACGTGAGCGTCGTGAATTTGTTGCCAATGTATCACATGAGTTACGTACACCTTTAACTTCTATGAATAGTTACATTGAAGCACTTGAAGAAGGTGCATGGAAAGATGAGGAACTTGCGCCACAATTTTTATCTGTTACCCGTGAAGAAACAGAACGAATGATTCGACTGGTCAATGACTTGCTACAGTTATCTAAAATGGATAATGAGTCTGATCAAATCAACAAAGAAATTATCGACTTTAACATGTTCATTAATAAAATTATTAATCGACATGAAATGTCTGCGAAAGATACAACATTTATTCGAGATATTCCGAAAAAGACGATTTTCACAGAATTTGATCCTGATAAAATGACGCAAGTATTTGATAATGTCATTACAAATGCGATGAAATATTCTAGAGGCGATAAACGTGTCGAGTTCCACGTGAAACAAAATCCACTTTATAATCGAATGACGATTCGTATTAAAGATAATGGCATTGGTATTCCTATCAATAAAGTCGATAAGATATTCGACCGATTCTATCGTGTAGATAAGGCACGTACGCGTAAAATGGGTGGTACTGGATTAGGACTAGCCATTTCGAAAGAGATTGTGGAAGCGCACAATGGTCGTATTTGGGCAAACAGTGTAGAAGGTCAAGGTACATCTATCTTTATCACACTTCCATGTGAAGTCATTGAAGACGGTGATTGGGATGAATAA
cell wall metabolism sensor histidine kinase WalK6085.3988369923.5-0.3537832.7.13.3Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR02966248PF02518HATPase_cHistidine kinase-, DNA gyrase B-, and HSP90-like ATPaseCL0025His_Kinase_A92.8
SACOL_RS00120; SACOL_RS06505; SACOL_RS11695
Cytoplasmic Membraneno predicted signal peptide2446794351WP_000871607
MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNINQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEVIEDGDWDE
no data available 21166474
SACOL_RS00130SACOL0021S. aureus COLSAUPAN000034000walHCDSSACOL_RS00130hypothetical proteinchromosome+27485288191335unknownWP_001060131
ATGAATAATAAGGAGCATATTAAATCTGTCATTTTAGCACTACTCGTCTTGATGAGTGTCGTATTGACATATATGGTATGGAACTTTTCTCCTGATATTGCAAATGTCGACAATACAGATAGTAAGAAGAGTGAAACGAAACCTTTAACGACACCTATGACAGCCAAAATGGATACAACTATTACGCCATTTCAGATTATTCATTCGAAAAATGATCATCCAGAAGGAACGATTGCGACGGTATCTAATGTGAATAAACTGACGAAACCTTTGAAAAATAAAGAAGTGAAGTCCGTGGAACATGTTCGTCGTGATCATAACTTGATGATTCCTGATTTGAACAGTGATTTTATATTATTCGATTTTACGTATGATTTACCGTTATCAACATATCTTGGTCAAGTACTGAACATGAATGCGAAAGTACCAAATCATTTCAATTTCAATCGTTTGGTCATAGATCATGATGCTGATGATAATATCGTGCTTTATGCTATAAGCAAAGATCGCCACGATTACGTAAAATTAACAACTACAACGAAAAATGATCATTTTTTAGATGCATTAGCAGCAGTGAAAAAAGATATGCAACCATACACAGATATCATCACAAACAAAGATACAATTGATCGTACGACGCATGTTTTTGCACCAAGTAAACCTGAAAAGTTAAAAACATATCGCATGGTATTTAACACGATTAGTGTTGAGAAAATGAATGCTATACTATTTGACGATTCAACCATCGTTCGTAGTTCAAAGAGTGGTGTTACAACCTACAACAATAATACAGGTGTCGCAAACTATAACGATAAAAATGAAAAATATCATTATAAAAACCTGTCCGAAGATGAAGCGAGTTCCAGCAAAATGGAAGAAACGATTCCAGGAACCTTTGATTTTATTAATGGTCATGGTGGTTTCTTAAACGAAGACTTTAGATTGTTTAGTACGAATAATCAGTCAGGCGAGTTAACATATCAACGTTTCCTTAATGGTTATCCAACGTTTAATAAAGAAGGTTCTAATCAAATTCAAGTCACTTGGGGTGAAAAAGGCGTCTTTGACTATCGTCGTTCGTTATTACGCACCGACGTTGTTTTAAATAGTGAGGATAATAAATCGTTGCCGAAATTAGAGTCTGTACGTTCAAGCTTAGCGAACAATAGTGATATTAATTTTGAAAAAGTAACAAACATCGCTATCGGTTACGAAATGCAGGATAATTCAGATCATAATCACATTGAAGTGCAGATTAACAGTGAACTCGTACCGCGTTGGTATGTAGAATATGATGGCGAATGGTATGTTTATAACGATGGGAGGCTTGAATAA
hypothetical protein4445.7407150924.7-0.58536Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein CTIGR0171316.7PF07435YycHYycH proteinCL0285YycI_YycH451.5no significant predictionno predicted signal peptide1446982875WP_001060131
MNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTTPMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIPDLNSDFILFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRHDYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVFNTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKMEETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGEKGVFDYRRSLLRTDVVLNSEDNKSLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSDHNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
no data available
SACOL_RS00135SACOL0022S. aureus COLSAUPAN000035000walICDSSACOL_RS00135hypothetical proteinchromosome+2882029608789unknownWP_001104172
ATGAACTGGAAACTGACAAAGACACTTTTCATTTTCGTGTTTATTCTTGTCAACATCGTGTTAGTATCGATTTATGTTAATAAAGTCAATCGCTCACACATTAATGAAGTCGAGAGTAACAATGAAGTTAATTTTCAGCAAGAAGAAATTAAAGTACCGACTAGTATATTGAATAAATCAGTTAAAGGTATAAAATTAGAGCAAATTACAGGGCGATCAAAAGACTTTAGTTCTAAAGCTAAAGGCGATTCGGATTTGACCACATCAGATGGTGGAAAATTATTGAATGCGAACATTAGTCAATCGGTAAAGGTCAGTGACAATAACTTAAAAGATTTGAAAGATTATGTTAACAAGCGCGTATTTAAAGGTGCTGAATATCAATTAAGCGAGATTAGTTCAGATTCTGTAAAATATGAACAAACGTATGATGATTTTCCGATTTTAAATAACAGTAAAGCGATGTTGAACTTTAATATAGAAGATAACAAAGCGACTAGTTATAAACAATCAATGATGGATGACATTAAGCCCACAGATGGTGCAGATAAGAAGCATCAAGTGATTGGTGTGAGAAAAGCAATCGAGGCATTATATTATAATCGTTACTTGAAAAAAGGTGATGAAGTCATTAATGCTAGACTCGGTTACTACTCAGTCGTGAATGAAACGAATGTTCAATTGTTACAACCAAACTGGGAAATTAAAGTGAAGCATGACGGTAAGGATAAAACGAATACTTACTATGTCGAAGCGACAAATAATAACCCTAAAATTATTAATCATTAA
hypothetical protein2629.3692429931.6-0.621756PF09648YycIYycH proteinCL0285YycI_YycH175no significant predictionno predicted signal peptide1447026916WP_001104172
MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPTSILNKSVKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKRVFKGAEYQLSEISSDSVKYEQTYDDFPILNNSKAMLNFNIEDNKATSYKQSMMDDIKPTDGADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHDGKDKTNTYYVEATNNNPKIINH
no data available
SACOL_RS00140SACOL0023S. aureus COLSAUPAN000036000walJCDSSACOL_RS00140MBL fold metallo-hydrolasechromosome+2999830798801unknownWP_000088648
ATGAGCCGCTTGATACGCATGAGTGTATTAGCAAGTGGTAGTACAGGTAACGCCACTTTTGTAGAAAATGAAAAAGGTAGTCTATTAGTTGATGTTGGTTTGACTGGAAAGAAAATGGAAGAATTGTTTAGTCAAATTGACCGTAATATTCAAGATTTAAATGGTATTTTAGTAACCCATGAACATATTGATCATATTAAAGGATTAGGTGTTTTGGCGCGTAAATATCAATTGCCAATTTATGCGAATGAAAAGACTTGGCAGGCAATTGAAAAGAAAGATAGTCGCATCCCTATGGATCAGAAATTCATTTTTAATCCTTATGAAACAAAATCTATTGCAGGTTTCGATGTTGAATCGTTTAACGTGTCACATGATGCAATAGATCCGCAATTTTATATTTTCCATAATAACTATAAGAAGTTTACGATTTTAACGGATACGGGTTACGTGTCTGATCGTATGAAAGGTATGATACGTGGCAGCGATGCGTTTATTTTTGAGAGTAATCATGACGTCGATATGTTGAGAATGTGTCGTTATCCATGGAAGACGAAACAACGTATTTTAGGCGATATGGGTCATGTATCTAATGAGGATGCGGCTCATGCAATGACAGACGTGATTACAGGTAACACGAAACGTATTTACCTATCGCATTTATCACAAGACAATAACATGAAAGATTTGGCGCGTATGAGTGTTGGCCAAGTATTGAACGAACACGATATTGATACGGAAAAAGAAGTATTGCTATGTGATACGGATAAAGCTATTCCAACGCCAATATATACAATATAA
MBL fold metallo-hydrolase2666.3490430327.4-0.397368Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341333.5PF00753Lactamase_BMetallo-beta-lactamase superfamilyCL0381Metallo-HOrase81.1Cytoplasmicno predicted signal peptide0446010793WP_000088648
MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTHEHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVESFNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCRYPWKTKQRILGDMGHVSNEDAAHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLNEHDIDTEKEVLLCDTDKAIPTPIYTI
no data available
SACOL_RS00145SACOL0024S. aureus COLSAUPAN000037000adsACDSSACOL_RS00145multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase/3'-nucleotidasechromosome+31026333442319unknownWP_000645780
ATGAAAGCTTTATTACTTAAAACAAGTGTATGGCTCGTTTTGCTTTTTAGTGTAATGGGATTATGGCAAGTCTCGAACGCGGCTGAGCAGCATACACCAATGAAAGCACATGCAGTAACAACGATAGACAAAGCAACAACAGATAAGCAACAAGTACCGCCAACAAAGGAAGCGGCTCATCATTCTGGCAAAGAAGCGGCAACCAACGTATCAGCATCAGCGCAGGGAACAGCTGATGATACAAACAGCAAAGTAACATCCAACGCACCATCTAACAAACCATCTACAGTAGTTTCAACAAAAGTAAACGAAACACGCGACGTAGATACACAACAAGCCTCAACACAAAAACCAACTCACACAGCAACGTTCAAATTATCAAATGCTAAAACAGCATCACTTTCACCACGAATGTTTGCTGCTAATGCACCACAAACAACAACACATAAAATATTACATACAAATGATATCCATGGCCGACTAGCCGAAGAAAAAGGGCGTGTCATCGGTATGGCTAAATTAAAAACAGTAAAAGAACAAGAAAAGCCTGATTTAATGTTAGACGCAGGAGACGCCTTCCAAGGTTTACCACTTTCAAACCAGTCTAAAGGTGAAGAAATGGCTAAAGCAATGAATGCAGTAGGTTATGATGCTATGGCAGTCGGTAACCATGAATTTGACTTTGGATACGATCAGTTGAAAAAGTTAGAGGGTATGTTAGACTTCCCGATGCTAAGTACTAACGTTTATAAAGATGGAAAACGCGCGTTTAAGCCTTCAACGATTGTAACAAAAAATGGTATTCGTTATGGAATTATTGGTGTAACGACACCAGAAACAAAGACGAAAACAAGACCTGAAGGCATTAAAGGCGTTGAATTTAGAGATCCATTACAAAGTGTGACAGCGGAAATGATGCGTATTTATAAAGACGTAGATACATTTGTTGTTATATCACATTTAGGAATTGATCCTTCAACACAAGAAACATGGCGTGGTGATTACTTAGTGAAACAATTAAGTCAAAATCCACAATTGAAGAAACGTATTACAGTTATTGATGGTCATTCACATACAGTACTTCAAAATGGTCAAATTTATAACAATGATGCATTGGCACAAACAGGTACAGCACTTGCGAATATCGGTAAGATTACATTTAATTATCGCAATGGAGAGGTATCGAATATTAAACCGTCATTGATTAATGTTAAAGACGTTGAAAATGTAACACCGAACAAAGCATTAGCTGAACAAATTAATCAAGCTGATCAAACATTTAGAGCACAAACTGCAGAGGTAATTATTCCAAACAATACCATTGATTTCAAAGGAGAAAGAGATGACGTTAGAACGCGTGAAACAAATTTAGGAAACGCGATTGCAGATGCTATGGAAGCGTATGGCGTTAAGAATTTCTCTAAAAAGACTGACTTTGCCGTGACAAATGGTGGAGGTATTCGTGCCTCTATCGCAAAAGGTAAGGTGACACGCTATGATTTAATCTCAGTATTACCATTTGGAAATACGATTGCGCAAATTGATGTAAAAGGTTCAGACGTCTGGACGGCTTTCGAACATAGTTTAGGCGCACCAACAACACAAAAGGACGGTAAGACAGTGTTAACAGCGAATGGCGGTTTACTACATATCTCTGATTCAATCCGTGTTTACTATGATATAAATAAACCGTCTGGCAAACGAATTAATGCTATTCAAATTTTAAATAAAGAGACAGGTAAGTTTGAAAATATTGATTTAAAACGTGTATATCACGTAACGATGAATGACTTCACAGCATCAGGTGGCGACGGATATAGTATGTTCGGTGGTCCTAGAGAAGAAGGTATTTCATTAGATCAAGTACTAGCAAGTTATTTAAAAACAGCTAACTTAGCTAAGTATGATACGACAGAACCACAACGTATGTTATTAGGTAAACCAGCAGTAAGTGAACAACCAGCTAAAGGACAACAAGGTAGCAAAGGTAGTAAGTCTGGTAAAGATACACAACCAATTGGTGACGACAAAGTGATGGATCCAGCGAAAAAACCAGCTCCAGGTAAAGTTGTATTGTTGCTAGCGCATAGAGGAACTGTTAGTAGCGGTACAGAAGGTTCTGGTCGCACAATAGAAGGAGCTACTGTATCAAGCAAGAGTGGGAAACAATTGGCTAGAATGTCAGTGCCTAAAGGTAGCGCGCATGAGAAACAGTTACCAAAAACTGGAACTAATCAAAGTTCAAGCCCAGAAGCGATGTTTGTATTATTAGCAGGTATAGGTTTAATCGCGACTGTACGACGTAGAAAAGCTAGCTAA
multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase/3'-nucleotidase77210.049383424-0.480959MetabolismBiosynthesis of cofactors, prosthetic groups, and carriers; Transport and binding proteinsPyridine nucleotides; OtherNAD nucleotidaseTIGR01530134.4PF028725_nucleotid_C5'-nucleotidase, C-terminal domainno clan definedno clan defined141.4Cellwallsignal peptide predicted0446568434WP_000645780
MKALLLKTSVWLVLLFSVMGLWQVSNAAEQHTPMKAHAVTTIDKATTDKQQVPPTKEAAHHSGKEAATNVSASAQGTADDTNSKVTSNAPSNKPSTVVSTKVNETRDVDTQQASTQKPTHTATFKLSNAKTASLSPRMFAANAPQTTTHKILHTNDIHGRLAEEKGRVIGMAKLKTVKEQEKPDLMLDAGDAFQGLPLSNQSKGEEMAKAMNAVGYDAMAVGNHEFDFGYDQLKKLEGMLDFPMLSTNVYKDGKRAFKPSTIVTKNGIRYGIIGVTTPETKTKTRPEGIKGVEFRDPLQSVTAEMMRIYKDVDTFVVISHLGIDPSTQETWRGDYLVKQLSQNPQLKKRITVIDGHSHTVLQNGQIYNNDALAQTGTALANIGKITFNYRNGEVSNIKPSLINVKDVENVTPNKALAEQINQADQTFRAQTAEVIIPNNTIDFKGERDDVRTRETNLGNAIADAMEAYGVKNFSKKTDFAVTNGGGIRASIAKGKVTRYDLISVLPFGNTIAQIDVKGSDVWTAFEHSLGAPTTQKDGKTVLTANGGLLHISDSIRVYYDINKPSGKRINAIQILNKETGKFENIDLKRVYHVTMNDFTASGGDGYSMFGGPREEGISLDQVLASYLKTANLAKYDTTEPQRMLLGKPAVSEQPAKGQQGSKGSKSGKDTQPIGDDKVMDPAKKPAPGKVVLLLAHRGTVSSGTEGSGRTIEGATVSSKSGKQLARMSVPKGSAHEKQLPKTGTNQSSSPEAMFVLLAGIGLIATVRRRKAS
no data available
SACOL_RS00150S. aureus COLCDSSACOL_RS0015023S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmHchromosome+3371234191480unknownWP_000704775
ATGAAAATCACCATTTTAGCTGTAGGGAAACTAAAAGAGAAATATTGGAAGCAAGCCATAGCAGAATATGAAAAACGTTTAGGCCCATACACCAAGATAGACATCATAGAAGTTCCAGACGAAAAAGCACCAGAAAATATGAGTGACAAAGAAATTGAGCAAGTAAAAGAAAAAGAAGGCCAACGAATACTAGCCAAAATCAAACCACAATCCACAGTCATTACATTAGAAATACAAGGAAAGATGCTATCTTCCGAAGGATTGGCCCAAGAATTGAACCAACGCATGACCCAAGGGCAAAGCGACTTTGTTTTCGTCATTGGCGGATCAAACGGCCTGCACAAGGACGTCTTACAACGCAGTAACTACGCACTATCATTCAGCAAAATGACATTCCCACATCAAATGATGCGGGTTGTGTTAATTGAACAAGTGTACAGAGCATTTAAGATTATGCGAGGAGAAGCTTATCATAAGTAA
23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH1599.8588518306.2-0.461635Genetic information processingProtein synthesistRNA and rRNA base modificationrRNA large subunit m3Psi methyltransferase RlmHTIGR00246186.6PF02590SPOUT_MTasePredicted SPOUT methyltransferaseCL0098SPOUT206.9Cytoplasmicno predicted signal peptide0446627429WP_000704775
MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
no data available
SACOL_RS00155SACOL0026S. aureus COLSAUPAN000041000-CDSSACOL_RS00155hypothetical proteinchromosome+34411356671257unknownWP_000566670
ATGATAGACAACTTTATGCAGGTCCTTAAATTAATTAAAGAGAAACGTACCAATAATGTAGTTAAAAAATCTGATTGGGATAAAGGTGATCTATATAAAACTTTAGTCCATGATAAGTTACCCAAGCAGTTAAAAGTGCATATAAAAGAAGATAAATATTCAGTTGTAGGGAAGGTTGCTACTGGGAACTATAGTAAAGTTCCTTGGATTTCAATATATGATGAGAATATAACAAAAGAAACAAAGGATGGATATTATTTGGTATATCTTTTTCATCCGGAAGGAGAAGGCATATACTTATCTTTGAATCAAGGATGGTCAAAGATAAGTGATATGTTTCCGCGGGATAAAAATGCTGCAAAACAAAGAGCATTAACTTTATCTTCCGAACTCAATAAATATATTACATCAAATGAATTTAATACTGGAAGATTTTATTACGCAGAAAATAAAGATTCATCTTATGATTTAAAAAATGATTATCCATCAGGATATTCTCATGGATCAATAAGATTCAAATATTATGATTTGAATGAAGGATTCACAGAAGAAGATATGCTAGAGGATTTAAAGAAATTTTTAGAACTATTTAATGAATTAGCTTCAAAAGTTACAAAAACATCCTATGATAGCTTGGTCAATAGCATAGACGAAATACAGGAAGACAGCGAAATTGAAGAAATTAGAACAGCACAAAAAGATAAGACACTCAAGGAAGTGGAAGCACCTAAAGGAATAATTCCAAAATATAAAAAAGGTGTATCAAAGACTACTAAAAATGATTCAGAAATTGAAAAATCAAATAAAGAGAATAAATTAACCGGTAAAGTTGGAGAAAAATTAGCGCTAAATTACTTTAATGAGCTAATTGATAATAAAATAGACGAAGATAAGAAAGAACAGTTTAGGAATATTTTAAATGATAATCCAGGCTCTCAACACGGTCATGGCTATGATTTAGTAGCTTTTGATCCAACAAATACAGATAAAGCTGTAGAAAAATTTATTGAAATTAAAACATCTACATCTTCTAGTATTGAGGAACCATTTTTTATGTCGCTAAATGAAATGTTTGCTATGAAAGAATATAAGCAGAAATATTTAATATTAAGAATATTTAATGTTTCCGGTAAAGAACCACAATTTTATTTTATAGATCCATATGCAAATTATTCTGAATTTAAAGATGTAGATGATCTCATTGACAAAGTATTTAATGTAGAAGCTATTCAGTATAAAGTTTTTGGCGAAAAATGA
hypothetical protein4185.3285148642.4-0.775359PF12102DUF3578Domain of unknown function (DUF3578)no clan definedno clan defined179.1no significant predictionno predicted signal peptide0446488816WP_000566670
MIDNFMQVLKLIKEKRTNNVVKKSDWDKGDLYKTLVHDKLPKQLKVHIKEDKYSVVGKVATGNYSKVPWISIYDENITKETKDGYYLVYLFHPEGEGIYLSLNQGWSKISDMFPRDKNAAKQRALTLSSELNKYITSNEFNTGRFYYAENKDSSYDLKNDYPSGYSHGSIRFKYYDLNEGFTEEDMLEDLKKFLELFNELASKVTKTSYDSLVNSIDEIQEDSEIEEIRTAQKDKTLKEVEAPKGIIPKYKKGVSKTTKNDSEIEKSNKENKLTGKVGEKLALNYFNELIDNKIDEDKKEQFRNILNDNPGSQHGHGYDLVAFDPTNTDKAVEKFIEIKTSTSSSIEEPFFMSLNEMFAMKEYKQKYLILRIFNVSGKEPQFYFIDPYANYSEFKDVDDLIDKVFNVEAIQYKVFGEK
no data available
SACOL_RS00160SACOL0027S. aureus COLSAUPAN000053000-CDSSACOL_RS00160hypothetical proteinchromosome+3608236321240unknownWP_001282728
ATGAGTGATAATTTGTCATTATTCATTGACTATATCAATGATAATATAATCTATGGTAGTGAAATCAAACGGGAGAAATTAGAGAATTTATTTAATCAATTTGCTATAAAAAATGTTGAAAAGAACATTGTCTATGATGAACTGAAATCTTTAGATATTACAATCATTGAGTCACAGGATTCATATAAAAATAAATTGAAGAGATTATTTTCGGTTCTGTTGCAAAGTAAAAAAATATAG
hypothetical protein796.817089346.71-0.331646phenylacetic acid degradation protein paaNTIGR0228811.6PF17190RecG_NRecG N-terminal helical domainno clan definedno clan defined13.6no significant predictionno predicted signal peptide0447205472WP_001282728
MSDNLSLFIDYINDNIIYGSEIKREKLENLFNQFAIKNVEKNIVYDELKSLDITIIESQDSYKNKLKRLFSVLLQSKKI
no data available
SACOL_RS00165SACOL0028S. aureus COLSAUPAN000054000tnpCDSSACOL_RS00165IS6 family transposase IS431mecchromosome-3635337027675unknownWP_001106057
ATGAACTATTTCAGATATAAACAATTTAACAAGGATGTTATCACTGTAGCCGTTGGCTACTATCTAAGATATACATTGAGTTATCGTGATATATCTGAAATATTAAGGGAACGTGGTGTAAACGTTCATCATTCAACGGTCTACCGTTGGGTTCAAGAATATGCCCCAATTTTGTATCAAATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATCAAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATGCAGAGGGACATACATTAGATATTTGGTTGCGTAAGCAACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTCATTAAACAATTTGGTAAACCTCAAAAGGTAATTACAGATCAGGCACCTTCAACGAAGGTAGCAATGGCTAAAGTAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACATCGAAATATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGGTATCAAAGTATCAATACAGCAAAGAATACTTTAAAAGGTATTGAATGTATTTACGCTCTATATAAAAAGAACCGCAGGTCTCTTCAGATCTACGGATTTTCGCCATGCCACGAAATTAGCATCATGCTAGCAAGTTAA
IS6 family transposase IS431mec22410.42726915.2-0.601339PF13610DDE_Tnp_IS240DDE domainCL0219RNase_H133.2Cytoplasmicno predicted signal peptide0447028801WP_001106057
MNYFRYKQFNKDVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
no data available
SACOL_RS14355S. aureus COLCDSSACOL_RS14355thiolase-like proteinchromosome+3706337452390unknownWP_020444595
ATTCAACTTTGCAACAGAACCGTATTATGGAATAGAGATGTTGGTAACATTTATACAGGATCATTATACTTAAGTTTAATTTCGTTATTACAGAACCACACATTCCAACCAGAAGAGAAAGTATGTCTATTTAGTTATGGTTCAGGAGCAGTAGGAGAAATCTTTAGTGGTTCAATCGTTAAAGGATATGACAAAGCATTAGATAAAGAGAAACACTTAAATATGCTAGAATCTAGAGAGCAATTATCAGTCGAAGAATACGAAACATTCTTTAACAGATTTGATAATCAAGAATTTGATTTCGAACGTGAATTGACACAAGATCCATATTCAAAAGTATACTTATACAGTATAGAAGACCATATCAGAACATATAAGATAGAGAAATAA
thiolase-like protein1294.6725215244-0.53876hydroxymethylglutaryl-CoA synthaseTIGR01835115.5PF08540HMG_CoA_synt_CHydroxymethylglutaryl-coenzyme A synthase C terminalCL0046Thiolase50Cytoplasmicno predicted signal peptide0WP_020444595
MQLCNRTVLWNRDVGNIYTGSLYLSLISLLQNHTFQPEEKVCLFSYGSGAVGEIFSGSIVKGYDKALDKEKHLNMLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK
no data available
SACOL_RS14360SACOL0030S. aureus COLSAUPAN000098000-CDSSACOL_RS14360hypothetical proteinchromosome+3755037780231unknownWP_001797648
ATGCTTATTTTTTTATCTTACGATTTTGTACGTGCATGCTTGCCTAGGGGTATGGCTCGAGCCATTAGTCTCTCGCACATACTATTCCCTCAGGCGTCAGCACTTACAAAATCGGTTGTAATTTTCATTTTTATACGCATTCTTACTGAGATTATACTAATAAGAGGAATAGTAAAAGCAATTCTAAGTAAAATTGCAGATAAGAGGTTTGTTAAAAGCAGTTCTAAGTAA
hypothetical protein7611.65958537.420.893421Cytoplasmic Membraneno predicted signal peptide1WP_001797648
MLIFLSYDFVRACLPRGMARAISLSHILFPQASALTKSVVIFIFIRILTEIILIRGIVKAILSKIADKRFVKSSSK
no data available
SACOL_RS00175SACOL0031S. aureus COLSAUPAN000099000ugpQCDSSACOL_RS00175glycerophosphoryl diester phosphodiesterasechromosome+3832939072744unknownWP_000958858
ATGCTAACTGTATATGGACATAGAGGATTACCTAGTAAAGCTCCGGAAAATACAATTGCATCATTTAAAGCTGCTTCAGAAGTAGAAGGTATAAACTGGTTGGAGTTAGATGTTGCAATTACAAAAGATGAACAACTGATTATCATTCATGATGATTATTTAGAACGGACTACAAATATGTCCGGGGAAATAACTGAATTGAATTATGATGAAATTAAAGATGCTTCTGCAGGATCTTGGTTTGGTGAAAAATTCAAAGATGAACATTTGCCAACTTTCGATGATGTAGTAAAAATAGCAAATGAATATAATATGAATTTAAATGTAGAATTAAAAGGTATTACTGGACCGAATGGACTAGCACTTTCTAAAAGTATGGTTAAGCAAGTGGAAGAACAATTAACAAACTTAAATCAGAATCAAGAAGTGCTCATTTCAAGCTTTAATGTTGTGCTTGTTAAACTTGCAGAAGAAATCATGCCACAATATAACAGAGCAGTTATATTCCATACAACTTCGTTTCGTGAAGACTGGAGAACACTTTTAGATTACTGTAATGCTAAAATAGTAAACACTGAAGATGCCAAACTTACTAAAGCAAAAGTAAAAATGGTAAAAGAAGCGGGTTATGAATTGAACGTATGGACTGTAAACAAACCAGCACGTGCAAACCAACTTGCTAATTGGGGAGTTGATGGTATCTTTACAGACAATGCAGATAAAATGGTGCATTTGTCTCAATAG
glycerophosphoryl diester phosphodiesterase2474.6584827899.4-0.346559MetabolismEnergy metabolismMethanogenesistetrahydromethanopterin S-methyltransferase, subunit BTIGR0416612.4PF03009GDPDGlycerophosphoryl diester phosphodiesterase familyCL0384PLC151.9Cytoplasmicno predicted signal peptide0446881602WP_000958858
MLTVYGHRGLPSKAPENTIASFKAASEVEGINWLELDVAITKDEQLIIIHDDYLERTTNMSGEITELNYDEIKDASAGSWFGEKFKDEHLPTFDDVVKIANEYNMNLNVELKGITGPNGLALSKSMVKQVEEQLTNLNQNQEVLISSFNVVLVKLAEEIMPQYNRAVIFHTTSFREDWRTLLDYCNAKIVNTEDAKLTKAKVKMVKEAGYELNVWTVNKPARANQLANWGVDGIFTDNADKMVHLSQ
no data available
SACOL_RS00180SACOL0032S. aureus COLSAUPAN000100000maoCCDSSACOL_RS00180hypothetical proteinchromosome+3916939597429unknownWP_000872606
ATGAAATACGATGATTTTATAGTAGGAGAAACATTCAAAACAAAAAGCCTTCATATTACAGAAGAAGAAATTATCCAATTTGCAACAACTTTTGATCCTCAATATATGCATATAGATAAAGAAAAAGCAGAACAAAGTAGATTTAAAGGTATCATTGCATCTGGCATGCATACACTTTCAATATCATTTAAATTATGGGTAGAAGAAGGTAAATACGGAGAAGAAGTTGTAGCAGGAACACAAATGAATAACGTTAAATTTATTAAACCTGTATACCCAGGTAATACATTGTACGTTATCGCTGAAATTACAAATAAGAAATCCATAAAAAAAGAAAATGGACTCGTTACAGTGTCACTTTCAACATACAATGAAAATGAAGAAATTGTATTTAAGGGAGAAGTAACAGCACTTATTAATAATTCATAA
hypothetical protein1425.280316136.3-0.311268phenylacetic acid degradation protein paaNTIGR0227860.4PF01575MaoC_dehydratasMaoC like domainCL0050HotDog112.9no significant predictionno predicted signal peptide0446795350WP_000872606
MKYDDFIVGETFKTKSLHITEEEIIQFATTFDPQYMHIDKEKAEQSRFKGIIASGMHTLSISFKLWVEEGKYGEEVVAGTQMNNVKFIKPVYPGNTLYVIAEITNKKSIKKENGLVTVSLSTYNENEEIVFKGEVTALINNS
no data available
SACOL_RS00185SACOL0033S. aureus COLSAUPAN000101000mecACDSSACOL_RS00185PBP2a family beta-lactam-resistant peptidoglycan transpeptidase MecAchromosome-39643416522010unknownWP_063852655
TTGATGAAAAAGATAAAAATTGTTCCACTTATTTTAATAGTTGTAGTTGTCGGGTTTGGTATATATTTTTATGCTTCAAAAGATAAAGAAATTAATAATACTATTGATGCAATTGAAGATAAAAATTTCAAACAAGTTTATAAAGATAGCAGTTATATTTCTAAAAGCGATAATGGTGAAGTAGAAATGACTGAACGTCCGATAAAAATATATAATAGTTTAGGCGTTAAAGATATAAACATTCAGGATCGTAAAATAAAAAAAGTATCTAAAAATAAAAAACGAGTAGATGCTCAATATAAAATTAAAACAAACTACGGTAACATTGATCGCAACGTTCAATTTAATTTTGTTAAAGAAGATGGTATGTGGAAGTTAGATTGGGATCATAGCGTCATTATTCCAGGAATGCAGAAAGACCAAAGCATACATATTGAAAATTTAAAATCAGAACGTGGTAAAATTTTAGACCGAAACAATGTGGAATTGGCCAATACAGGAACAGCATATGAGATAGGCATCGTTCCAAAGAATGTATCTAAAAAAGATTATAAAGCAATCGCTAAAGAACTAAGTATTTCTGAAGACTATATCAAACAACAAATGGATCAAAATTGGGTACAAGATGATACCTTCGTTCCACTTAAAACCGTTAAAAAAATGGATGAATATTTAAGTGATTTCGCAAAAAAATTTCATCTTACAACTAATGAAACAGAAAGTCGTAACTATCCTCTAGAAAAAGCGACTTCACATCTATTAGGTTATGTTGGTCCCATTAACTCTGAAGAATTAAAACAAAAAGAATATAAAGGCTATAAAGATGATGCAGTTATTGGTAAAAAGGGACTCGAAAAACTTTACGATAAAAAGCTCCAACATGAAGATGGCTATCGTGTCACAATCGTTGACGATAATAGCAATACAATCGCACATACATTAATAGAGAAAAAGAAAAAAGATGGCAAAGATATTCAACTAACTATTGATGCTAAAGTTCAAAAGAGTATTTATAACAACATGAAAAATGATTATGGCTCAGGTACTGCTATCCACCCTCAAACAGGTGAATTATTAGCACTTGTAAGCACACCTTCATATGACGTCTATCCATTTATGTATGGCATGAGTAACGAAGAATATAATAAATTAACCGAAGATAAAAAAGAACCTCTGCTCAACAAGTTCCAGATTACAACTTCACCAGGTTCAACTCAAAAAATATTAACAGCAATGATTGGGTTAAATAACAAAACATTAGACGATAAAACAAGTTATAAAATCGATGGTAAAGGTTGGCAAAAAGATAAATCTTGGGGTGGTTACAACGTTACAAGATATGAAGTGGTAAATGGTAATATCGACTTAAAACAAGCAATAGAATCATCAGATAACATTTTCTTTGCTAGAGTAGCACTCGAATTAGGCAGTAAGAAATTTGAAAAAGGCATGAAAAAACTAGGTGTTGGTGAAGATATACCAAGTGATTATCCATTTTATAATGCTCAAATTTCAAACAAAAATTTAGATAATGAAATATTATTAGCTGATTCAGGTTACGGACAAGGTGAAATACTGATTAACCCAGTACAGATCCTTTCAATCTATAGCGCATTAGAAAATAATGGCAATATTAACGCACCTCACTTATTAAAAGACACGAAAAACAAAGTTTGGAAGAAAAATATTATTTCCAAAGAAAATATCAATCTATTAACTGATGGTATGCAACAAGTCGTAAATAAAACACATAAAGAAGATATTTATAGATCTTATGCAAACTTAATTGGCAAATCCGGTACTGCAGAACTCAAAATGAAACAAGGAGAAACTGGCAGACAAATTGGGTGGTTTATATCATATGATAAAGATAATCCAAACATGATGATGGCTATTAATGTTAAAGATGTACAAGATAAAGGAATGGCTAGCTACAATGCCAAAATCTCAGGTAAAGTGTATGATGAGCTATATGAGAACGGTAATAAAAAATACGATATAGATGAATAA
PBP2a family beta-lactam-resistant peptidoglycan transpeptidase MecA6699.1132576305.2-0.7089693.4.16.4Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanpenicillin-binding protein 2TIGR03423305PF00905TranspeptidasePenicillin binding protein transpeptidase domainCL0013Beta-lactamase239.9
SACOL_RS01530; SACOL_RS11615
Cytoplasmic Membraneno predicted signal peptide1WP_063852655
MMKKIKIVPLILIVVVVGFGIYFYASKDKEINNTIDAIEDKNFKQVYKDSSYISKSDNGEVEMTERPIKIYNSLGVKDINIQDRKIKKVSKNKKRVDAQYKIKTNYGNIDRNVQFNFVKEDGMWKLDWDHSVIIPGMQKDQSIHIENLKSERGKILDRNNVELANTGTAYEIGIVPKNVSKKDYKAIAKELSISEDYIKQQMDQNWVQDDTFVPLKTVKKMDEYLSDFAKKFHLTTNETESRNYPLEKATSHLLGYVGPINSEELKQKEYKGYKDDAVIGKKGLEKLYDKKLQHEDGYRVTIVDDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNMKNDYGSGTAIHPQTGELLALVSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKILTAMIGLNNKTLDDKTSYKIDGKGWQKDKSWGGYNVTRYEVVNGNIDLKQAIESSDNIFFARVALELGSKKFEKGMKKLGVGEDIPSDYPFYNAQISNKNLDNEILLADSGYGQGEILINPVQILSIYSALENNGNINAPHLLKDTKNKVWKKNIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAELKMKQGETGRQIGWFISYDKDNPNMMMAINVKDVQDKGMASYNAKISGKVYDELYENGNKKYDIDE
no data available 21166474
SACOL_RS00190SACOL0034S. aureus COLSAUPAN000102000mecR1CDSSACOL_RS00190beta-lactam sensor/signal transducer MecR1chromosome+4174942735987unknownWP_001549960
GTGTTATCATCTTTTTTAATGTTAAGTATAATCAGTTCATTGCTCACGATATGTGTAATTTTTTTAGTGAGAATGCTCTATATAAAATATACTCAAAATATTATGTCACATAAGATTTGGTTATTAGTGCTCGTCTCCACGTTAATTCCATTAATACCATTTTACAAAATATCGAATTTTACATTTTCAAAAGATATGATGAATCGAAATGTATCTGACACGACTTCTTCGGTTAGTCATATGTTAGATGGTCAACAATCATCTGTTACGAAAGACTTAGCAATTAATGTTAATCAGTTTGAGACCTCAAATATAACGTATATGATTCTTTTGATATGGGTATTTGGTAGTTTGTTGTGCTTATTTTATATGATTAAGGCATTCCGACAAATTGATGTTATTAAAAGTTCGTCATTGGAATCGTCATATCTTAATGAACGACTTAAAGTATGTCAAAGTAAGATGCAGTTCTACAAAAAGCATATAACAATTAGTTATAGTTCAAACATTGATAATCCGATGGTATTTGGTTTAGTGAAATCCCAAATTGTACTACCAACTGTCGTAGTCGAAACCATGAATGACAAAGAAATTGAATATATTATTCTACATGAACTATCACATGTGAAAAGTCATGACTTAATATTCAACCAGCTTTATGTTGTTTTTAAAATGATATTCTGGTTTAATCCTGCACTATATATAAGTAAAACAATGATGGACAATGACTGTGAAAAAGTATGTGATAGAAACGTTTTAAAAATTTTGAATCGCCATGAACATATACGTTATGGTGAATCGATATTAAAATGCTCTATTTTAAAATCTCAGCACATAAATAATGTGGCAGCACAATATTTACTAGGTTTTAATTCAAATATTAAAGAACGTGTTAAGTATATTGCACTTTATGATTCAATGCCTAAACCTAATCGAAACAAGCGTATTGTTGCGTATATTGTATGTAGTATATCGAGCTTCACATGA
beta-lactam sensor/signal transducer MecR13289.4371338128.90.244817PF05569Peptidase_M56BlaR1 peptidase M56CL0126Peptidase_MA338.5Cytoplasmic Membraneno predicted signal peptide3486201760WP_001549960
MLSSFLMLSIISSLLTICVIFLVRMLYIKYTQNIMSHKIWLLVLVSTLIPLIPFYKISNFTFSKDMMNRNVSDTTSSVSHMLDGQQSSVTKDLAINVNQFETSNITYMILLIWVFGSLLCLFYMIKAFRQIDVIKSSSLESSYLNERLKVCQSKMQFYKKHITISYSSNIDNPMVFGLVKSQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMMDNDCEKVCDRNVLKILNRHEHIRYGESILKCSILKSQHINNVAAQYLLGFNSNIKERVKYIALYDSMPKPNRNKRIVAYIVCSISSFT
no data available
SACOL_RS00195SACOL0035S. aureus COLSAUPAN000103000rplLCDSSACOL_RS00195type I restriction endonucleasechromosome+4270742967261unknownWP_001549961
TTGTATGTAGTATATCGAGCTTCACATGAAACAGCTAAAGAAGCTTTGGGCGATAAAGAGTTAAGAGCCATTGCACATGAGTTAACTAAAACAGTTAAGGATAACATGAGTGTTGATTGGTCTAAACGAGACAGTGCTAAAGCTAAAATGAGAGTTCAAGTTAGACGCCTATTAAAGAAATATGGCTATCCACCAGATCTTCAAAAAATGGCTGTGGAACAAGTTGTAGAGCAAGCAGAATTAATGGCAAGTCAGCAATAA
type I restriction endonuclease869.976539923.43-0.682558PF11867DUF3387Domain of unknown function (DUF3387)no clan definedno clan defined105.6no significant predictionno predicted signal peptide0486201762WP_001549961
MYVVYRASHETAKEALGDKELRAIAHELTKTVKDNMSVDWSKRDSAKAKMRVQVRRLLKKYGYPPDLQKMAVEQVVEQAELMASQQ
no data available
SACOL_RS00200SACOL0036S. aureus COLSAUPAN000107000-CDS, pseudogeneSACOL_RS00200IS5/IS1182 family transposasechromosome-42977446131637unknown
ATACATGGAGGTCAATATGGAAACAAAACAAATCAACATCGTTTTACTGTAAATGATATTGTTGAAACAATTCCTGACAATGAATTCGACGAATTCAGACATCACCGTGGTGCAACTTCGTACCATCCTAAAATGATGTTAAAAGTGATTCTATATGCCTACACACAATCTGTATTCTCAGGTCGTAAAATAGAAAAAATGCTTAATGATAGCATCCGAATGATGTGGCTATCACAAAATCAAAAACCTTCTTATAAAACAATTAATCAATTTAGAGTAAATCCAAAAGTAGATGCTTTATTAGAATCTTTATTTATTCAATTTTACAGTCAGTGTGTAAAACAAAATCTTATAGATGATAAAGCTATTTTTATTGATGGTACAAAAATTGAAGCAAATGCCAATCGATATACATTTGTATGGAAAAAGAGTATTCAAAACCATGAATCAAAGATGAATGAGGATTCTAAAGCCCTCTACCATGAATTGGTAACCAATAAAATCATACCGGAAATTAAAGAAGATCATGATAATGAATTAACAAAAGAAGAAATAGATTTGATTGGTAGTCACTTAGATAAAGAAATCGAAGATTTAAACCAACATATCAACAATGAAAAATGTACTAAAACAAGAAAACAAATACGTCTCAAAAGAACTAAAATCAAAAAATACAAAAAGCAAATCAATGATTATTTTGAGCGAAAGTATCGATACGAATTTCAAAAATCTATTTTAAAGGATAGAAATAGTTATTCTAAGACAGATTATGATGCGACATTTATGAGAATGAAAGAAGATCACATGAAAAATGGACAACTTAAGCCAGGGTATAATTTACAAATAGCAACAAATTCCCAATTTGTTTTATCTTATAATGTGTATCAAAATCCAACGGATACTAGAACGATGATTCCATTTTTAAATTCAATTCAAGAGACCTACGGTCATTTACCTGAATATATTGTAGCTGATGCAGGTTATGGTAGTGAATCAAATTATAAGGCAATTATAGATGACTTTAATCGAACGCCACTCATAACATATGGAATGTTTATAAAAGATAAAACTAAAAAATATAAAAGTGACATCTTTAATACTCAAAATTGGAACTATGACGAAATTAATGACGAATTCATTTGTCCGAATAATAAACGGCTAGGTTTTAAAAGATATGCCTATCGTCATGATAAGTATGGTTATAAGCGAGACTTCAAATTATATGAATGTGATGATTGTTCAGAATGTCCTCTGAAAAATCAATGTATGAACTTCAATTCAAAAACAAACAAAAAAATAATGAAGAATTATAACTGGGAATATTTTAAATCCCAAATTAACAAAAAGCTTTCAGAACCAGAAACAAAAAATATCTACAGTCAAAGAAAAATTGATGTGGAACCTGTTTTTGGATTTATGAAGGCTATTTTGGGTTTCACTCGGATGTCTGTCCGAGGACTCAATAAAGTCAAAAGAGAACTTGGTTTTGTATTAATGGCACTTAATATAAGAAAAGTAGTAGCTCAACGAGCTGAAAATAATCAAAAAATTTATAAAAAAGACAATTTCTATATTATTTCAATAGAAATTGTCTTTTTTCACTTATCCAAGAACTTTATGTCCCGGACTCATTATGA
IS5/IS1182 family transposase0no predicted signal peptideno data available
SACOL_RS00205SACOL0037S. aureus COLSAUPAN000126000-CDSSACOL_RS00205hypothetical proteinchromosome-4461745123507unknownWP_001092195
ATGAATACAATCAAAAGTACGATAAACACAGAAGCCATATTTAGCGATGATGAACAACACCGCTATTTACTCAAGAAAACATGGGATGAAAAGAAACCCGCTTGTACAGTGATAACGATGTACCCTCATTTAGATGGTGTATTATCACTCGATCTCACAACTGTTCTTATCCTCAATCAATTAGCTAATACTGAACAATATGGTGCTGTATATCTTGTAAATCTATTTTCAAATATTAGAACACCCGAAAACCTCAAACATATCAAAAATCCATACGATGAGCACACTGATATTCATTTGATGAAAGCGATTAGTGAAAGTGACACAGTGATTCTTGCTTATGGTGCCTATGCGAAGCGACCAGTTGTTATCGACCGTGTCGAACAAGTGATGGAAATGTTAAAACCTCATAAAAAGAAAGTAAAAAAGCTCATCAATCCAGTAACAAATGAAATTATGCATCCACTCAACCCTAAGGCACGTCAAAAATGGATTTTGAAATCATAG
hypothetical protein1689.4877619407.5-0.364881PF07799DUF1643Protein of unknown function (DUF1643)no clan definedno clan defined85.4no significant predictionno predicted signal peptide0447014939WP_001092195
MNTIKSTINTEAIFSDDEQHRYLLKKTWDEKKPACTVITMYPHLDGVLSLDLTTVLILNQLANTEQYGAVYLVNLFSNIRTPENLKHIKNPYDEHTDIHLMKAISESDTVILAYGAYAKRPVVIDRVEQVMEMLKPHKKKVKKLINPVTNEIMHPLNPKARQKWILKS
no data available
SACOL_RS00210SACOL0038S. aureus COLSAUPAN000132000-CDSSACOL_RS00210hypothetical proteinchromosome-4513845449312unknownWP_001024803
ATGAACATCAATCGATATATCACAAGAGGCATTAGTGAACACCTATCTCTAGATCTTCAAATCTTACTTTGGAACATGGTAAAAGAAAGAGATAATCAACCTGATACAGATTACCTACACATTTTTAGACTGAAAGAAGATGAGAATATACTTTCAATCATACATGAGCAAGAACAACCCACGTACAAATTGGAATATCACTATACAAACTATATAAAAAATCAAAATGCATTACCTAAGAAAGTCTACGTCATCCGAGAAGATGATGTAGATGTTTTTTATTATGTGATGCTTTTACCAGAAGAATACTAA
hypothetical protein1034.7185412654.3-0.623301PF06124DUF960Staphylococcal protein of unknown function (DUF960)no clan definedno clan defined94.1no significant predictionno predicted signal peptide0446947547WP_001024803
MNINRYITRGISEHLSLDLQILLWNMVKERDNQPDTDYLHIFRLKEDENILSIIHEQEQPTYKLEYHYTNYIKNQNALPKKVYVIREDDVDVFYYVMLLPEEY
no data available
SACOL_RS00215SACOL0040S. aureus COLSAUPAN000133000-CDSSACOL_RS00215hypothetical proteinchromosome-4553645886351unknownWP_000859157
ATGAAAACAACCACTCAAGAACTCAAACAATATATAACTCGTCTATTCCAACTATCTAACAATGAAACATGGGAATGTGAAGCGTTAGAAGAAGCAGCAGAAAATATACTTCCTACTCGCTTTGTAGACCATACCCCACTTGCGCATCTTACACTTGACACTTATACCTACTATAATGATGAGCTACATGAGCTAAGTATCTATCCATTTCTAATGTACACCAATAACCAACTCATCAGTATCGGTTATCTGGATCATTTTGACATGGACTTTTTATATCTCACAGATACTAAAAATACGATTATCGATGAACGTCATCTACTAAAAGAAGGAGGGACTCGCCATGAATAA
hypothetical protein1164.4017513823.4-0.532759PF06106SAUGIS. aureus uracil DNA glycosylase inhibitorno clan definedno clan defined232.3no significant predictionno predicted signal peptide0446781901WP_000859157
MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPTRFVDHTPLAHLTLDTYTYYNDELHELSIYPFLMYTNNQLISIGYLDHFDMDFLYLTDTKNTIIDERHLLKEGGTRHE
no data available
SACOL_RS00220S. aureus COLCDS, pseudogeneSACOL_RS00220recombinase RecBchromosome-46352479761625unknown
ATGGATAAAATGAAGAAAAAGCTTGTAGGAGGCTACATTCGTGTGTCCACAGAGAGACAAGTAGAAGGTTATAGCATAGAGGGACAAATTACACAAATAGAGCAATATTGCCAATTTAACGGCTATGAACTTGTTGATATATATGCAGATCGGGGTATATCAGGAAAATCTATGAACCGTCCTGAATTACAGCGCATGTTAAATGATGCTAAAAATGGAAAATTAGACTGTGTTATGGTTTATAAAACAAATCGTTTGGCACGTAATACTTCCGATTTACTTACAATAGTCGAAGAACTTCATCGCCAAAATGTTGAATTTTTTAGCTTGTCTGAACGTATGGAAGTCAAAAATTCAACAGGCAAGTTAATGCTCCAGATACTTGCAAGTTTTTCCGAATTCGAAAGAAATACAATTTTAGAGAATATTTACACCGGACAACGTCAAAGAGCTTTAGAGGGCTATTATCAAGGCAATCTTCCATTAGGATATAATAACATACCTGATAATAAAAAAGAATTAATGATTAATCAACATGAAGCTAACATCGTTAAATATATCTTTGAATCTTATGCCAAAGGTCATGGTTATCGTAAAATAGCCAATGCATTCAATCACAAAGGCTATGTGACTAAAAAAGGCAATCCATTTAGTATTTCAGCTGTTACTTATATTCTCTCAAACCCATTCTATATTGGTAAAATTCAATTCGCGAAATACAAAGATTGGAATGATAAACGACGTAAAGGATTAAACGATAAGCCAGTAATCGCTGAAGGTAAACACACGCCTATTATTAGTCAATCATTATGGGATAAAGTGCAAGCACGTAAGAAACAAGTAAGTGAAAAACCACAAGTCCATGGTAAAGGAACCAATATTTTAACTGGAATAATTTCGTGTCCCCAATGTTCTGCACCTATGGCTGCGAGTAACACCACAAACACACTTAAAGATGGCACTAAAAACGTATTCGTTACTATTCGTGTAGTAATTTTCGAAATAAAGGCTCAAAGGTATGTTCTGCGAATAGTGTTAGAGCCGATGTCATTGAAAAATATGTTATGGACCAAATACTTGAAATTGTCAAAAGTGATAAAGTTCTCAAACAAGTTGTCGAACGTGTCAATCAAGAGAATCAAGTCGATGTAGCTGCACTTAACCATGATATTGCTTATAAACAACAACAATTTGATGAAATTAGCACTAAACTTAAAAATCTAATTCAAACCATCGAAGACAATCCAGACTTAACATCTGCACTCAAACCAACCATTCATCAATATGAAACACAACTGAATGATATCACAAACCAAATTAATCAACTCAAGCACCAACAAAATCAAGAGAAACCATTTTATGATACTAAACAAATCGCTGCTTTATTACAACGAATATTTCAAAATATAGAATCCATGGATAAATCACAGCTCAAAGCTTTGTACCTAACGGTTATTGACCGTATTGACATTCGTAAAGATGAGAATCATAAAAAGCAATTCTTTGTTACACTAAAACTTAATAATGAAATTATTAAACAACTTTTCAATAATAATAATCTAGACGAAGTGCTTCTCAGCACTTCGTCTTTGTTTTTGCCTCAAACACTCTACTTTCAAATATAA
recombinase RecB0no predicted signal peptideno data available
SACOL_RS00225SACOL0042S. aureus COLSAUPAN000445000ccrACDSSACOL_RS00225recombinase family proteinchromosome-47998493471350unknownWP_000806247
ATGAAACAAGCAATAGGTTACTTACGACAGAGCACTACAAAGCAACAATCCTTAGCAGCACAAAAACAAACCATCGAGGCATTAGCCAAAAAACATAATATTCAATACATTACCTTTTATAGCGATAAGCAATCAGGACGCACTGATAAGCGGAACGGTTACCAACAAATTACTGAACTGATTCAACAAGGACAATGTGATGTATTATGTTGTTACAGATTAAACCGACTTCATCGCAATCTTAAAAATGCATTAAAACTCATGAAATTGTGTCAAAAATACCATGTCCATATCTTAAGCGTTCATGATGGCTATTTTGATATGGATAAAGCATTCGATCGGCTCAAACTCAATATTTTCATCAGCTTGGCCGAACTAGAATCTGATAATATAGGCGAACAAGTCAAAAATGGAATCAAAGAAAAAGCGAAACAAGGTAAAATGATTACAACACATGCACCCTTTGGGTATCACTATCATAATGGTACTTTCACGATAGACACAGTAAAAGCACCAACAGTAAAAGCTGTGTTCAATTATTACCTTCAAGGTTATGGTTATAAAAAAATTGCGCAATACTTAGAAGCTGATGATAAATTCATTAATCGTAAGCCCTATCAAGTGCGTAATATTATCCTTAACCCTAATTACTGTGGCCGTGTTATCAATCAATACGGACAATATGAAAACATGTTCCCAGCTATTGTCAGTACAACGATATACGAAGAAGCTCAAGTTACCCGAACTCAGAAACCAGTAAAACGTAAGCCGTCAGAAAACCAACTCAAACAAAAAATCAAATGTCCTTATTGTGATTCAACACTAACTAATATGACCATTAGAAAAAAGCACCATACATTACGTTATTATGTTTGTCCTCAAAATATGAATGCATCTCGTTTTGTCTGTGAATTCAAAGGGATCAACGCACAAGAATTAGAAACAAGTGTTTTAGCGACTTGTCAGGACTTCTTTCAAAATCAACAGCTCTATTCAAAAATAAACCATACTATTCAACAACGACTCAAAAGACAAAGAGATATAGAAACTAAAACTACACTCAATCACGAGCAGCTGATAGAAAAATTAGCCCAAGACAAAATTGATGCAGAAACGTTCAGAGAACAAACGCAATCATTACGTCAGCAATCAAAACCTATATCATCAATCAGTACGTATCAAATTCGAAAAGCTTTCCAAAACATCATTCAACAACGTTTCACGCTAAACATGTTGTACCCCTATATTGATGAAATTAATATTTCTAAAAATAAAAGCCTCGCTGGCATCTATTTCAAAAATGAACCACTGAATATTGTAAAGCAGACTATGGAATTATCAATTGTATAA
recombinase family protein4499.9384952580.1-0.659688Hypothetical proteinsConservedconserved hypothetical proteinTIGR0232815.1PF00239ResolvaseResolvase, N terminal domainno clan definedno clan defined127.4Cytoplasmicno predicted signal peptide0446728934WP_000806247
MKQAIGYLRQSTTKQQSLAAQKQTIEALAKKHNIQYITFYSDKQSGRTDKRNGYQQITELIQQGQCDVLCCYRLNRLHRNLKNALKLMKLCQKYHVHILSVHDGYFDMDKAFDRLKLNIFISLAELESDNIGEQVKNGIKEKAKQGKMITTHAPFGYHYHNGTFTIDTVKAPTVKAVFNYYLQGYGYKKIAQYLEADDKFINRKPYQVRNIILNPNYCGRVINQYGQYENMFPAIVSTTIYEEAQVTRTQKPVKRKPSENQLKQKIKCPYCDSTLTNMTIRKKHHTLRYYVCPQNMNASRFVCEFKGINAQELETSVLATCQDFFQNQQLYSKINHTIQQRLKRQRDIETKTTLNHEQLIEKLAQDKIDAETFREQTQSLRQQSKPISSISTYQIRKAFQNIIQQRFTLNMLYPYIDEINISKNKSLAGIYFKNEPLNIVKQTMELSIV
no data available
SACOL_RS00230SACOL0043S. aureus COLSAUPAN000446000-CDSSACOL_RS00230hypothetical proteinchromosome-49535513041770unknownWP_000017983
ATGAGTCATCATGACATTTTTAGACTAGGCCTATACCATTTAGATACAATGGGTTGGCATAAAACTATCCCACCTAAAAAAGATGGAGATGAGAAAAAAGTAGTGACTATGTCTAGTTGTATGGCTGTTGAAGCTAAATTTTGGCATGTCTTAGAAAATACAGAAAAAATAATTATTTCTAACGGTAAGGATAAAGAACATACATTTGACTCTGATATTTTAACAACTCGAAAGTTACCTTCCTTGATTAAATATGGTCACAGTATCAATGAAAATTATATAAAAGATTTGAGCTATGCACTACAATTAATGCGCGATGAAATGCCCACTTCTGATTTATATGATGGCTCGGGCATCATAGAAACACCCCACGGTTATATTGTAATGATAGATACCATTTATACATCTAAACAATATGATCAATTATCATCTTTAGATCCTATTGTCGATAGTGCTTATCCATTAGAGCCTAAAGGTACATTTAAAGATTGGTTAAATATGTATATTAACGAAGTCAAAGGTCATCTTCTTCTAGAGTTAGCGGTCGTATTTGGAATTTCTGCCTTAGTGACAAGCTTTCTGAAGTACAAACGTGAAATCGAATTTGCAGGAATTATCTTTAGTTTTACAGGCCAGTCATCAACTGGTAAATCAACAGCAGCAGCTTTAGCAGTATCCGTCGCTGGAAATCCAACTAAAGGTAATCAAACACTTTTTCGAAGTTGGAATGCCACACGTAATGCACTTGAAAGTTACTTGAGTAACAATTTTGGTATACCTATTGTATTTGATGAACTCTCATCAGCAACTTTTAAAGATACAACGGGGTTATTGTACTCTATCGCTGAAGGTCAAGGGCGTCAACGTTCCAATGTACACGGAGAAGTTAAAACGCCTAAGAATTGGGGCACTTCTGTGATTTCAACCTCTGAATACAGTATCTTTACTGATTCTGCTCAAAACGATGGATTACGTGTAAGAACCATCGAGATTAATGAACAATTTACTACAAATGCGACCAATGCTGACAATATCAAAAAAGCTGTGGCACTAAACCATGGTCATGTTTTACCGTTAGTAGCTCAATACCTTATAAATCGTGAAGATGAAGTTATTCAATGGTTTTACAAGGAAGTAGATTGGTTTGAAGCTAAATTGAACAGTGAAACAAACAATACAGGTATTCGTATGTTTAAGCGTTATGCAGTCATTACAACATCTGCGAAAATATTAGGTCGTGTTTTAGCTACAGATATTGATATCGCTAAAATCAGAGACTACTTTATTGATTATCATGCTCATACAGTCTCTGAACGATCACTGGCAGATAAAGCGATCGAAGTCATTACTCAATTTGTAGCACAAAACCGTGGTAAATTTTCTGATGATACAGCGTTAAAGAATATGTTCGAGAACTATGGACTAATTGCCTTAAAAGATAATCATATCGAAGTCAAAATCATTGCGTCTGTATTTAAAAATATGTTGTTAGAGCATCACTTCCAAGATGTTAATAATGTTGTTAATGCGCTAAGGGATAAAGGATTTATCGAATCTGACCATGATCGAATTACAACAAAAAGAACAGTCAAAGATGGCAATGGCAAAAAACAGTCACTTGTCTTTTACCATTTAAAGCTAGATTCAGAATATGCGTCTATTTTTGGTCTAACTAAAGATGCTGAACCTATTAAAGCTGAAATTAACTTGGATAACAAAAAGATACTTGAATCATGGAAAAAACAGAATGATGATTTAATTGATTTTTAA
hypothetical protein5896.5625366710.1-0.331919PF06048DUF927Domain of unknown function (DUF927)CL0023P-loop_NTPase212.3no significant predictionno predicted signal peptide0445940128WP_000017983
MSHHDIFRLGLYHLDTMGWHKTIPPKKDGDEKKVVTMSSCMAVEAKFWHVLENTEKIIISNGKDKEHTFDSDILTTRKLPSLIKYGHSINENYIKDLSYALQLMRDEMPTSDLYDGSGIIETPHGYIVMIDTIYTSKQYDQLSSLDPIVDSAYPLEPKGTFKDWLNMYINEVKGHLLLELAVVFGISALVTSFLKYKREIEFAGIIFSFTGQSSTGKSTAAALAVSVAGNPTKGNQTLFRSWNATRNALESYLSNNFGIPIVFDELSSATFKDTTGLLYSIAEGQGRQRSNVHGEVKTPKNWGTSVISTSEYSIFTDSAQNDGLRVRTIEINEQFTTNATNADNIKKAVALNHGHVLPLVAQYLINREDEVIQWFYKEVDWFEAKLNSETNNTGIRMFKRYAVITTSAKILGRVLATDIDIAKIRDYFIDYHAHTVSERSLADKAIEVITQFVAQNRGKFSDDTALKNMFENYGLIALKDNHIEVKIIASVFKNMLLEHHFQDVNNVVNALRDKGFIESDHDRITTKRTVKDGNGKKQSLVFYHLKLDSEYASIFGLTKDAEPIKAEINLDNKKILESWKKQNDDLIDF
no data available
SACOL_RS00235SACOL0044S. aureus COLSAUPAN000447000-CDSSACOL_RS00235hypothetical proteinchromosome-5130451600297unknownWP_000120684
ATGTCTTACAAGCAAGAAGATGATTTTAAAAAATTAAAAAATAGAATTTTAGGTATTTCAATTAATTTACCAGAAGGACAAACATTTACTTTCCATGACTTGAACCGTCGTGCAAATGTACAATGCTCAAAAGCTGTACAACAAAATGTTGGACGTTGGTTCGCATATTTTGTAAAACAAGCGCCACGTGTTCCATTTATTATTATCGGTAAAAATACCAATGGTCATTTAGTATATATGAAAGTCGGACCTAATCCACTCAATGATAGCAACCCTTCGAAAGGAGGTGTTCGCTAA
hypothetical protein9810.783411148.8-0.566327PF07205DUF1413Domain of unknown function (DUF1413)no clan definedno clan defined57.4no significant predictionno predicted signal peptide0446042829WP_000120684
MSYKQEDDFKKLKNRILGISINLPEGQTFTFHDLNRRANVQCSKAVQQNVGRWFAYFVKQAPRVPFIIIGKNTNGHLVYMKVGPNPLNDSNPSKGGVR
no data available
SACOL_RS00240SACOL0045S. aureus COLSAUPAN000372000-CDSSACOL_RS00240hypothetical proteinchromosome+51771533481578unknownWP_000271874
GTGTATGATTTTTTAGAATACTTACATCGTTATTGTATAAAATCAATTAATAATTGGGAGGCTGTTGCAGACATATCATGCAAAGTTGAACGTGGAAATGTTAGTACGGGCTATTATGTTAAACAAGATAGAATTGTAATAGATGATAGTGATATACCTCCAATTATTAAAATAAGTGGAAGTTATATAGCAGCAGACATATTAGTTACTAGATATTTAGATGGAATGGGTGAATTTATAAAGGTATCAAAATTAGATCAATCGAGCTATTACGAATGGTTTATGTTTGTTGAAGAAACGAGAAGAATATTTAGAGGTACAGAAATAGTTTATCAATTTTTAAAATATCTATTTACGCATACCTATGAACATAAAAATGAAGAAAAAAGAATAGAAAAACATATGAAAAACATTATCATAGATAATCAATTTAGAGGGCAGCATATCAATGATATCGTTCGTTTAGACATGAAAGATGATAATATGTTATTTTACAATTTTGATATATACGATACAAATGTTCTTTATAAAGAAATAGACGAGGAAAAATTACTTAGAATTTTAGATGAAATAAGTAATACTGACAATTACAAAGCGCTATTTAACATTATAAGTGAGAATCAAAAGAAATTTTGGAAATCAAATATTAAACCAATTGTAAGTGAATGTTCAGATGGTATAAATACAACCACATTTGATTTATATGCTTATGTAAATAAGTATATAAGTAATAAAATATTTGACTGTGATAATTATTTAATTACTAAAAATGAGGTTGTGGATTTCTATTTTAATCATGGTAGTGACTTTAATAATTTCAAGATGGGACAGACAGGCACAAAGTCCAAATTTAAGCAGGGAAATAAACTTAAAATACACGAATATATCATTGCAGTAACTTATGTAAATTTATTAAATCATTCATATATGAAATATATCAATGCTGAAAGTTACTATGACCCTAGCAAAAAAATAATAAAAGGAATGAAAAATGATTATCATAAATTTACAGATTCATTCAGTGATTTTGTAGAAATGGTGGACGATATAACATGGAGAATCCGTGATTCGTTTGATTATATTGGAGGATTAAAAAATAAAGAAATTAGCGAAGATGAGAACGAATATATCGAACAATTAATTCAATTTGTTATATTATCTAAATTCGGCTATATGAATGTGGAAAATCATTTTAATTATATTGAGAACTTAAATACACTTAATAACGAATTAACGACTATATTAAGAAGTGAATTCGCGCACATTTCAAATGATATGTATAATAATTTATTTGGTAATTTATTCGATGTTGTAAATACATGGAAAAAAGATTATTCAAATAATTTTTATAATAATACTCAGAATACTATACCTACAGAAAAATTAGATATAATATCTTCATTTATAAAACAATATGATAAACCAATTGAACGAGACGAACATGGCAAACACGTTAAAGCAAAAGTGTTTGAAGGTATAAGTGATTTTCATAAGCGTGTAAAAAAAGGATTTGATAATAATGATGTGCTATTGCATTTGAGATTGGAAATGAGTGTACATGAAAATAAGTATGATTAA
hypothetical protein5255.7504362590.2-0.567619PF08389Xpo1Exportin 1-like proteinCL0020TPR14.4Cytoplasmicno predicted signal peptide0446194019WP_000271874
MYDFLEYLHRYCIKSINNWEAVADISCKVERGNVSTGYYVKQDRIVIDDSDIPPIIKISGSYIAADILVTRYLDGMGEFIKVSKLDQSSYYEWFMFVEETRRIFRGTEIVYQFLKYLFTHTYEHKNEEKRIEKHMKNIIIDNQFRGQHINDIVRLDMKDDNMLFYNFDIYDTNVLYKEIDEEKLLRILDEISNTDNYKALFNIISENQKKFWKSNIKPIVSECSDGINTTTFDLYAYVNKYISNKIFDCDNYLITKNEVVDFYFNHGSDFNNFKMGQTGTKSKFKQGNKLKIHEYIIAVTYVNLLNHSYMKYINAESYYDPSKKIIKGMKNDYHKFTDSFSDFVEMVDDITWRIRDSFDYIGGLKNKEISEDENEYIEQLIQFVILSKFGYMNVENHFNYIENLNTLNNELTTILRSEFAHISNDMYNNLFGNLFDVVNTWKKDYSNNFYNNTQNTIPTEKLDIISSFIKQYDKPIERDEHGKHVKAKVFEGISDFHKRVKKGFDNNDVLLHLRLEMSVHENKYD
no data available
SACOL_RS00245SACOL0046S. aureus COLSAUPAN000509000-CDSSACOL_RS00245Zn-dependent hydrolasechromosome-53428547561329unknownWP_000465464
ATGTTTTTTAAACAATTTTATGATAAACATTTATCTCAAGCATCTTATTTAATCGGTTGTCAAAAAACTGGAGAAGCCATGATTATTGATCCTATTCGTGACTTATCTTCATATATTCGAGTTGCTGATGAAGAAGGTTTAACCATTACTCATGCAGCTGAAACACATATACATGCAGATTTTGCTTCAGGAATTAGAGATGTTGCTATAAAGTTAAATGCTAATATTTATGTATCGGGTGAAAGTGATGACACATTAGGTTATAAAAATATGCCTAACCACACTCATTTTGTTCAACATAATGACGATATTTATGTAGGAAATATAAAATTAAAAGTGCTTCATACACCGGGTCACACGCCAGAAAGTATAAGTTTTTTACTTACTGACGAAGGTGCTGGAGCACAAGTTCCAATGGGACTATTCAGTGGTGATTTTATTTTTGTAGGAGATATCGGTAGACCTGATTTACTAGAAAAAGCGGTTAAAGTAGAAGGATCATCTGAAATAGGCGCTAAACAAATGTTTAAATCGATTGAAAGTATTAAAGACTTGCCAGATTACATTCAAATTTGGCCTGGCCATGGCGCTGGTAGTCCTTGTGGTAAATCTTTAGGTGCTATTCCAACATCTACTCTTGGCTATGAAAAACAAACGAACTGGGCTTTTTCTGAAAATAACGAAGCTACCTTTATCGATAAACTCATTTCTGACCAACCTGCACCACCACATCATTTTGCACAAATGAAAAAAATTAATCAATTCGGTATGAATTTATATCAACCTTATACGGTTTATCCAGCTACAAATACAAACAGATTAACTTTTGATCTCCGCAGTAAGGAGGCTTATCATGGTGGACATATTGAAGGTACAATCAATATTCCATATGATAAAAATTTCATCAATCAAATTGGCTGGTATCTAAACTATGATCAAGAAATTAACTTGATTGGAGACTATCACCTTGTTTCAAAAGCAACACACACCTTACAACTCATTGGATACGATGATATTGCTGGATATCAATTACCGCAATCTAAGATTCAAACACGTTCCATTCATAGTGAAGACATTACAGGTAACGAATCACATATATTAGATGTACGTAATGATAATGAATGGAATAATGGCCACTTATCTCAAGCGGTTCATGTACCACACGGCAAACTTTTAGAAACAGATTTACCTTTCAATAAAAACGATGTTATTTATGTACACTGTCAGTCTGGCATTAGAAGTTCGATAGCTATTGGTATTTTAGAACACAAAGGTTATCACAACATTATTAATGTAAATGAAGGTTATAAAGATATACAACTTTCTTAA
Zn-dependent hydrolase4425.9773649410-0.387104Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341374.5PF00581RhodaneseRhodanese-like domainCL0031Phosphatase66.3Cytoplasmicno predicted signal peptide0446387609WP_000465464
MFFKQFYDKHLSQASYLIGCQKTGEAMIIDPIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGAQVPMGLFSGDFIFVGDIGRPDLLEKAVKVEGSSEIGAKQMFKSIESIKDLPDYIQIWPGHGAGSPCGKSLGAIPTSTLGYEKQTNWAFSENNEATFIDKLISDQPAPPHHFAQMKKINQFGMNLYQPYTVYPATNTNRLTFDLRSKEAYHGGHIEGTINIPYDKNFINQIGWYLNYDQEINLIGDYHLVSKATHTLQLIGYDDIAGYQLPQSKIQTRSIHSEDITGNESHILDVRNDNEWNNGHLSQAVHVPHGKLLETDLPFNKNDVIYVHCQSGIRSSIAIGILEHKGYHNIINVNEGYKDIQLS
no data available
SACOL_RS00250SACOL0047S. aureus COLSAUPAN000110000-CDSSACOL_RS00250dihydroneopterin aldolasechromosome-54775558421068unknownWP_000085031
ATGTCACAATATAAAACGAAACACATTAATGATTTCACTAAAAAAGAATTACAAGAATTGAGTTCTAAGGGTCAATTAATTGACGTTCGACATCCTGAAGAATTTGAATTAGGACACATTAAAAACGCTTTATTACATTCAGTTGAAAATATAGAGACTTTTAAACAAAGCAAAAATAAAACTTACTATATCTATTGTAAAAGTGGTAATAGAAGTAGAAAAGCCAGTCAATTTCTTGCACAACGCGGATACGATGTAGTGAATTTAGACGGAGGTTATACCGCATACGAACAACAACATCATAATGATAATTTATCTAAAGTAAAAGAAGATAGAGAAATTAAAGATAATCGTAAGACATTCAATTATAGTAATCTACAGTGTCCAGGACCTATTGTTAATATTAGTAAAGAAATCAAAAACATCGCTATTGGCGATCAAATAGAAGTTGTTGTGACTGATCACGGATTTTTAAATGATATTAAAAGTTGGGTCAAACAAACTGGACATACGCTTGTTAGACTCAACGATTTTGGCAATGAAATTCGCGCTATTATTCAAAAAGAAGAAAATAAAAATATAGAAGTGACACACACGAAAAGTGGAACAACAATTGTTTTATTTAGCGGCGAGCTAGATAAAGCAGTTGCAGCAATGATTATTGCTAATGGTGCTAAAGCTGCAGGTAGAGATGTAACCATTTTTTGCACATTTTGGGGCTTAAATGCACTTAAAAAAATTCAAAGTCAACGTATTAAGAAAAAAGGTATTGCAAAACTTTTTGACTTCATGCTTCCAAATTCACCAATTAACATGCCTATTTCTAAAATGAATATGTTTGGTTTAGGCAATCTAATGATGCGTTATGTCATGAAAAAGAAAAATGTCGATACTTTACCTTCTCTTATTGATCAAGCAGTTGAGCAAGGTGTTAAACTTATCGCTTGTACAATGAGTATGGATGTGATGGGCATTACAAAAGAAGAACTACGTGATGATGTAGAATACGGTGGCGTAGGTGCATATATTGGATATACAGAACAAGCTAATCACAATTTATTTATATAA
dihydroneopterin aldolase3559.2967340204.9-0.434085Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA 2-selenouridine synthaseTIGR0316737.6PF13686DrsE_2DsrE/DsrF/DrsH-like familyCL0394DsrEFH-like184.7Cytoplasmicno predicted signal peptide0446007176WP_000085031
MSQYKTKHINDFTKKELQELSSKGQLIDVRHPEEFELGHIKNALLHSVENIETFKQSKNKTYYIYCKSGNRSRKASQFLAQRGYDVVNLDGGYTAYEQQHHNDNLSKVKEDREIKDNRKTFNYSNLQCPGPIVNISKEIKNIAIGDQIEVVVTDHGFLNDIKSWVKQTGHTLVRLNDFGNEIRAIIQKEENKNIEVTHTKSGTTIVLFSGELDKAVAAMIIANGAKAAGRDVTIFCTFWGLNALKKIQSQRIKKKGIAKLFDFMLPNSPINMPISKMNMFGLGNLMMRYVMKKKNVDTLPSLIDQAVEQGVKLIACTMSMDVMGITKEELRDDVEYGGVGAYIGYTEQANHNLFI
no data available
SACOL_RS00255SACOL0048S. aureus COLSAUPAN000111000-CDSSACOL_RS00255hypothetical proteinchromosome+5598156241261unknownWP_000456194
TTGGAATATAATAAAAAGATGATTAATCGTATTCATCGCATACAAGGACAGCTTAATGGAGTCATTAAAATGATGGAGGAAGAAAAAAATTGTAAAGACGTCATTAGTCAATTAAGTGCATCTAAAAGTTCTATTCAACGTTTAATGGGTATTATTATTAGCGAGAACTTAGTAGAATGCGTCAAAATGTCTGAAGAAAATAGTGAAGATTCTCAGGCACTAATTAATGAAGCTGTTGAATTATTAATAAAAAGTAAATGA
hypothetical protein865.886169811.4-0.359302PF02583Trns_repr_metalMetal-sensitive transcriptional repressorno clan definedno clan defined79.9no significant predictionno predicted signal peptide0446378339WP_000456194
MEYNKKMINRIHRIQGQLNGVIKMMEEEKNCKDVISQLSASKSSIQRLMGIIISENLVECVKMSEENSEDSQALINEAVELLIKSK
no data available
locus tagold locus tagnew locus tagorganismpan locus tagpan gene symboltypesymbolsynonymproductcommentrepliconstrandstartendgene lengthessentialGene IDgene RefSeqMicrobesOnlineDNAdescriptionprotein lengththeoretical pItheoretical MWGRAVYECTIGRFAM Meta RoleTIGRFAM Main RoleTIGRFAM Sub RoleTIGRFAM functionTIGRFAMTIGRFAM HMM scoreTheSEEDPFAM AccessionPFAMPFAM descriptionPFAM clan accessionPFAM clanPFAM HMM scoreeffectorinteraction partnersPSORTbLocatePSignalPtransmembrane helicesprotein GIUniProtprotein RefSeqprotein sequenceprotein peptides detectedprotein copies per celloperonregulatorpubmed
SA0001SA_RS00145S. aureus N315SAUPAN000006000dnaACDSdnaAchromosome replication initiator DnaAchromosome+51718781362yes1122772NP_373239102265
ATGTCGGAAAAAGAAATTTGGGAAAAAGTGCTTGAAATTGCTCAAGAAAAATTATCAGCTGTAAGTTACTCAACTTTCCTAAAAGATACTGAGCTTTACACGATTAAAGATGGTGAAGCTATCGTATTATCGAGTATTCCTTTTAATGCAAATTGGTTAAATCAACAATATGCTGAAATTATCCAAGCAATCTTATTTGATGTTGTAGGCTATGAAGTTAAACCTCACTTTATTACTACTGAAGAATTAGCAAATTATAGTAATAATGAAACTGCTACTCCAAAAGAAACAACAAAACCTTCTACTGAAACAACTGAGGATAATCATGTGCTTGGTAGAGAGCAATTCAATGCCCATAACACATTTGACACTTTTGTAATCGGACCTGGTAACCGCTTTCCACATGCAGCAAGTTTAGCTGTAGCCGAAGCACCAGCCAAAGCGTACAATCCATTATTTATCTATGGAGGGGTTGGTTTAGGAAAAACCCATTTAATGCATGCCATTGGTCATCATGTTTTAGATAATAATCCAGATGCCAAAGTGATTTACACATCAAGTGAAAAATTCACAAATGAATTTATTAAATCAATTCGTGATAACGAAGGTGAAGCTTTCAGAGAAAGATATCGTAATATCGACGTCTTATTAATCGATGATATTCAGTTCATACAAAATAAAGTACAAACACAAGAAGAATTTTTCTATACTTTTAATGAATTGCATCAGAATAACAAGCAAATAGTTATTTCGAGTGATCGACCACCAAAGGAAATTGCACAATTAGAAGACCGATTACGTTCACGCTTTGAATGGGGGCTAATTGTTGATATTACGCCACCAGATTATGAAACTCGAATGGCAATTTTGCAGAAGAAAATTGAAGAAGAAAAATTAGATATTCCACCAGAAGCTTTAAATTATATAGCAAATCAAATTCAATCTAATATTCGTGAATTAGAAGGTGCATTAACACGTTTACTTGCATATTCACAATTATTAGGAAAACCAATTACAACTGAATTAACTGCTGAAGCTTTAAAAGATATCATTCAAGCACCAAAATCTAAAAAGATTACCATCCAAGATATTCAAAAAATTGTAGGCCAGTACTATAATGTTAGGATTGAAGATTTCAGTGCAAAAAAACGTACAAAGTCAATTGCATATCCGCGTCAAATAGCTATGTACTTGTCTAGAGAGCTTACAGATTTCTCATTACCTAAAATTGGTGAAGAATTTGGTGGGCGTGATCATACGACCGTCATTCATGCTCATGAAAAAATATCTAAAGATTTAAAAGAAGATCCTATTTTTAAACAAGAAGTAGAGAATCTTGAAAAAGAAATAAGAAATGTATAA
chromosome replication initiator DnaA4535.1162651965.3-0.488742Genetic information processingDNA metabolismDNA replication, recombination, and repairchromosomal replication initiator protein DnaATIGR00362594.7DNA Metabolism / DNA replication / DNA-replication / Chromosomal replication initiator protein DnaA; Cell Division Subsystem including YidCD / Chromosomal replication initiator protein DnaAPF00308Bac_DnaABacterial dnaA proteinCL0023P-loop_NTPase340.4CytoplasmicIntracellularno predicted signal peptide015925706P68866NP_373239
MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
no data available MicrobesOnline: SA0001 > SA000211952893
SA0002SA_RS00150S. aureus N315SAUPAN000007000dnaNCDSdnaNDNA polymerase III subunit betachromosome+215632891134no1122773NP_373240102266
ATGATGGAATTCACTATTAAAAGAGATTATTTTATTACACAATTAAATGACACATTAAAAGCTATTTCACCAAGAACAACATTACCTATATTAACTGGTATCAAAATCGATGCGAAAGAACATGAAGTTATACTAACTGGTTCAGACTCTGAAATTTCAATAGAAATCACTATTCCTAAAACTGTAGATGGCGAAGATATTGTCAATATTTCAGAAACAGGCTCAGTAGTACTTCCTGGACGATTCTTTGTTGATATTATAAAAAAATTACCTGGTAAAGATGTTAAATTATCTACAAATGAACAATTCCAGACATTAATTACATCAGGTCATTCTGAATTTAATTTAAGTGGCTTAGATCCAGATCAATATCCTTTATTACCTCAAGTTTCTAGAGATGACGCAATTCAATTGTCGGTAAAAGTGCTTAAAAACGTGATTGCACAAACGAATTTTGCAGTGTCCACCTCAGAAACACGCCCAGTACTAACTGGTGTGAACTGGCTTATACAAGAAAATGAATTAATATGCACAGCGACTGACTCACACCGCTTGGCTGTAAGAAAGTTGCAGTTAGAAGATGTTTCTGAAAACAAAAATGTCATCATTCCAGGTAAGGCTTTAGCTGAATTAAATAAAATTATGTCTGACAATGAAGAAGACATTGATATCTTCTTTGCTTCAAACCAAGTTTTATTTAAAGTTGGAAATGTGAACTTTATTTCTCGATTATTAGAAGGACATTATCCTGATACAACACGTTTATTCCCTGAAAACTATGAAATTAAATTAAGTATAGACAATGGGGAGTTTTATCATGCGATTGATCGTGCCTCTTTATTAGCACGTGAAGGTGGTAATAACGTTATTAAATTAAGTACAGGTGATGACGTTGTTGAATTATCTTCTACATCACCAGAAATTGGTACTGTAAAAGAAGAAGTTGATGCAAACGATGTTGAAGGTGGTAGCCTGAAAATTTCATTCAACTCTAAATATATGATGGATGCTTTAAAAGCAATCGATAATGATGAGGTTGAAGTTGAATTCTTCGGTACAATGAAACCATTTATTCTAAAACCAAAAGGTGACGACTCGGTAACGCAATTAATTTTACCAATCAGAACTTACTAA
DNA polymerase III subunit beta3774.4028441913.3-0.1615382.7.7.7Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, beta subunitTIGR00663375.1DNA Metabolism / DNA replication / DNA-replication / DNA polymerase III beta subunit (EC 2.7.7.7); Cell Division Subsystem including YidCD / DNA polymerase III beta subunit (EC 2.7.7.7)PF00712DNA_pol3_betaDNA polymerase III beta subunit, N-terminal domainCL0060DNA_clamp184CytoplasmicIntracellularno predicted signal peptide015925707P99103NP_373240
MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIRTY
no data available MicrobesOnline: SA0001 > SA000215590099
SA0003SA_RS00155S. aureus N315SAUPAN000009000-CDSSA0003hypothetical proteinchromosome+36703915246no1122774NP_373241102267
GTGATTATTTTGGTTCAAGAAGTTGTAGTAGAAGGAGACATTAATTTAGGTCAATTTCTAAAAACAGAAGGGATTATTGAATCTGGTGGTCAAGCAAAATGGTTCTTGCAAGACGTTGAAGTATTAATTAATGGAGTGCGTGAAACACGTCGCGGTAAAAAGTTAGAACATCAAGATCGTATAGATATCCCAGAATTACCTGAAGATGCTGGTTCTTTCTTAATCATTCATCAAGGTGAACAATGA
hypothetical protein814.355789137.35-0.197531Genetic information processingDNA metabolismDNA replication, recombination, and repairS4 domain protein YaaATIGR0298890Hypothetical Coupled to RecF / FIG002958: hypothetical proteinPF13275S4_2S4 domainCL0492S474.4
SA0107; SA0133; SA0218; SA0245; SA0342; SA0366; SA0437; SA0475; SA0483; SA0486; SA0494; SA0495; SA0497; SA0500; SA0503; SA0505; SA0506; SA0545; SA0562; SA0605; SA0618; SA0627; SA0637; SA0641; SA0687; SA0727; SA0728; SA0729; SA0730; SA0731; SA0759; SA0819; SA0823; SA0859; SA0873; SA0915; SA0934; SA0941; SA0992; SA1036; SA1074; SA1088; SA1100; SA1150; SA1170; SA1206; SA1234; SA1305; SA1308; SA1342; SA1359; SA1365; SA1382; SA1394; SA1409; SA1456; SA1517; SA1518; SA1533; SA1535; SA1553; SA1572; SA1599; SA1609; SA1704; SA1715; SA1836; SA1887; SA1901; SA1914; SA1927; SA1938; SA1940; SA1941; SA1959; SA1984; SA2016; SA2023; SA2027; SA2034; SA2046; SA2048; SA2098; SA2204; SA2312; SA2334; SA2341; SA2378; SA2395; SA2399; SA2400; SA2427; SA2428
CytoplasmicIntracellularno predicted signal peptide015925708A0A0H3JN22NP_373241
MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ
no data available MicrobesOnline: SA0003 > SA0004 > SA0005 > SA000621166474
SA0004SA_RS00160S. aureus N315SAUPAN000010000recFCDSrecFrecombination protein Fchromosome+391250241113yes1122775NP_373242102268
ATGAAGTTAAATACACTCCAATTAGAAAATTATCGTAACTATGATGAGGTTACGTTGAAATGTCATCCTGACGTGAATATCCTCATTGGAGAAAATGCACAAGGAAAGACAAATTTACTTGAATCAATTTATACCTTAGCTTTAGCAAAAAGTCATAGAACGAGTAATGATAAGGAACTCATACGTTTTAATGCTGATTATGCTAAAATAGAAGGTGAGCTTAGTTATAGACACGGCACGATGCCATTAACAATGTTTATAACTAAAAAAGGTAAACAAGTCAAAGTGAATCACTTAGAGCAAAGTCGTCTAACTCAATATATTGGACACCTCAATGTGGTTCTATTTGCGCCAGAAGATTTGAATATTGTAAAAGGCTCTCCTCAAATAAGACGACGCTTTATAGATATGGAGTTGGGCCAAATTTCTGCTGTTTACTTAAATGATTTAGCTCAATACCAACGTATTTTAAAGCAAAAGAATAATTACTTAAAGCAGTTACAATTAGGCCAAAAAAAGGACTTAACAATGTTGGAAGTATTAAATCAGCAGTTTGCTGAATATGCAATGAAAGTAACTGATAAACGTGCACATTTTATTCAAGAGCTAGAGTCGTTAGCTAAACCGATTCATGCTGGTATCACAAATGATAAAGAAGCGTTGTCGCTAAATTATTTACCTAGTCTTAAATTTGATTATGCTCAAAATGAAGCGGCACGACTTGAAGAAATTATGTCTATTCTTAGCGATAATATGCAAAGAGAAAAAGAACGAGGCATTAGCTTATTCGGACCACATCGAGATGATATAAGTTTTGATGTGAATGGCATGGATGCTCAAACATATGGTTCTCAAGGACAGCAACGTACAACGGCTTTGTCCATTAAATTAGCTGAAATTGAGTTAATGAATATCGAAGTTGGGGAATATCCCATCTTATTATTAGACGATGTACTCAGTGAATTAGATGATTCGCGTCAAACGCATTTATTAAGTACGATTCAGCATAAAGTACAAACATTTGTCACTACGACATCTGTAGATGGTATTGATCATGAAATCATGAATAACGCTAAATTGTATCGTATTAATCAAGGTGAAATTATAAAGTAA
recombination protein F3706.4468842415.1-0.444054Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA replication and repair protein RecFTIGR00611474.6DNA Metabolism / DNA repair / DNA repair, bacterial RecFOR pathway / DNA recombination and repair protein RecF; Cell Division Subsystem including YidCD / DNA recombination and repair protein RecF; Hypothetical Coupled to RecF / DNA recombination and repair protein RecFPF02463SMC_NRecF/RecN/SMC N terminal domainCL0023P-loop_NTPase60.4
SA0218; SA0232; SA0495; SA0496; SA0497; SA0498; SA0505; SA0506; SA0731; SA0802; SA0940; SA0943-1; SA0944; SA0946; SA1029; SA1084; SA1099; SA1112; SA1244; SA1245; SA1271; SA1473; SA1504; SA1510; SA1517; SA1520; SA1532; SA1553; SA1716; SA1885; SA1984; SA2022; SA2024; SA2029; SA2031; SA2033; SA2034; SA2035; SA2038; SA2041; SA2042; SA2044; SA2045; SA2046; SA2047; SA2334; SA2400; SAS052
CytoplasmicIntracellularno predicted signal peptide015925709P68862NP_373242
MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKLYRINQGEIIK
no data available MicrobesOnline: SA0003 > SA0004 > SA0005 > SA000621166474
SA0005SA_RS00165S. aureus N315SAUPAN000011000gyrBCDSgyrBDNA gyrase subunit Bchromosome+503469681935yes1122776NP_373243102269
ATGGTGACTGCATTGTCAGATGTAAACAACACGGATAATTATGGTGCTGGGCAAATACAAGTATTAGAAGGTTTAGAAGCAGTACGTAAAAGACCAGGTATGTATATAGGATCGACTTCAGAGAGAGGTTTGCACCATTTAGTGTGGGAAATTGTCGATAATAGTATCGATGAAGCATTAGCTGGTTATGCAAATAAAATTGAAGTTGTTATTGAAAAAGATAACTGGATTAAAGTAACGGATAACGGACGTGGTATCCCAGTTGATATTCAAGAAAAAATGGGACGTCCAGCTGTCGAAGTTATTTTAACTGTTTTACATGCTGGTGGTAAATTCGGCGGTGGCGGATACAAAGTATCTGGTGGTTTACATGGTGTTGGTTCATCAGTTGTAAACGCATTGTCACAAGACTTAGAAGTATATGTACACAGAAATGAGACTATATATCATCAAGCATATAAAAAAGGTGTACCTCAATTTGACTTAAAAGAAGTTGGCACAACTGATAAGACAGGTACTGTCATTCGTTTTAAAGCAGATGGAGAAATCTTCACAGAGACAACTGTATACAACTATGAAACATTACAGCAGCGTATTAGAGAGCTTGCTTTCTTAAACAAAGGAATTCAAATCACATTAAGAGATGAACGTGATGAAGAAAACGTTAGAGAAGACTCCTATCACTATGAGGGCGGTATTAAATCGTACGTTGAGTTATTGAACGAAAATAAAGAACCTATTCATGATGAGCCAATTTATATTCATCAATCTAAAGATGATATTGAAGTAGAAATTGCGATTCAATATAACTCAGGATATGCCACAAATCTTTTAACTTACGCAAATAACATTCATACGTATGAAGGTGGTACGCATGAAGACGGATTCAAACGTGCATTAACGCGTGTCTTAAATAGTTATGGTTTAAGTAGCAAGATTATGAAAGAAGAAAAAGATAGACTTTCTGGTGAAGATACACGTGAAGGTATGACAGCAATTATATCTATCAAACATGGTGATCCTCAATTCGAAGGTCAAACGAAGACAAAATTAGGTAATTCTGAAGTGCGTCAAGTTGTAGATAAATTATTCTCAGAGCACTTTGAACGATTTTTATATGAAAATCCACAAGTCGCACGTACAGTGGTTGAAAAAGGTATTATGGCGGCACGTGCACGTGTTGCTGCGAAAAAAGCGCGTGAAGTAACACGTCGTAAATCAGCGTTAGATGTAGCAAGTCTTCCAGGTAAATTAGCCGATTGCTCTAGTAAAAGTCCTGAAGAATGTGAGATTTTCTTAGTCGAAGGGGACTCTGCCGGGGGGTCTACAAAATCTGGTCGTGACTCTAGAACGCAGGCGATTTTACCATTACGAGGTAAGATATTAAATGTTGAAAAAGCACGATTAGATAGAATTTTGAATAACAATGAAATTCGTCAAATGATCACAGCATTTGGTACAGGAATCGGTGGCGACTTTGATCTAGCGAAAGCAAGATATCACAAAATCGTCATTATGACTGATGCCGATGTGGATGGAGCGCATATTAGAACATTGTTATTAACATTCTTCTATCGATTTATGAGACCGTTAATTGAAGCAGGCTATGTGTATATTGCACAGCCACCGTTGTATAAACTGACACAAGGTAAACAAAAGTATTATGTATACAATGATAGGGAACTTGATAAACTTAAATCTGAATTGAATCCAACACCAAAATGGTCTATTGCACGATACAAAGGTCTTGGAGAAATGAATGCAGATCAATTATGGGAAACAACAATGAACCCTGAGCACCGCGCTCTTTTACAAGTAAAACTTGAAGATGCGATTGAAGCGGACCAAACATTTGAAATGTTAATGGGTGACGTTGTAGAAAACCGTAGACAATTTATAGAAGATAATGCAGTTTATGCAAACTTAGACTTCTAA
DNA gyrase subunit B6445.7942772539.4-0.4905285.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, B subunitTIGR01059993.9DNA Metabolism / DNA replication / DNA topoisomerases, Type II, ATP-dependent / DNA gyrase subunit B (EC 5.99.1.3); Virulence, Disease and Defense / Resistance to antibiotics and toxic compounds / Resistance to fluoroquinolones / DNA gyrase subunit B (EC 5.99.1.3); Cell Division Subsystem including YidCD / DNA gyrase subunit B (EC 5.99.1.3)PF00204DNA_gyraseBDNA gyrase BCL0329S5211.7
SA0006; SA0505; SA1112; SA1520
CytoplasmicIntracellularno predicted signal peptide015925710P66937NP_373243
MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANKIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
no data available MicrobesOnline: SA0003 > SA0004 > SA0005 > SA000611952893; 20686482; 21166474
SA0006SA_RS00170S. aureus N315SAUPAN000012000gyrACDSgyrADNA gyrase subunit Achromosome+700596742670yes1122777NP_373244102270
ATGGCTGAATTACCTCAATCAAGAATAAATGAACGAAATATTACCAGTGAAATGCGTGAATCATTTTTAGATTATGCGATGAGTGTTATCGTTGCTCGTGCATTGCCAGATGTTCGTGACGGTTTAAAACCAGTACATCGTCGTATACTATATGGATTAAATGAACAAGGTATGACACCGGATAAATCATATAAAAAATCAGCACGTATCGTTGGTGACGTAATGGGTAAATATCACCCTCATGGTGACTCATCTATTTATGAAGCAATGGTACGTATGGCTCAAGATTTCAGTTATCGTTATCCGCTTGTTGATGGCCAAGGTAACTTTGGTTCAATGGATGGAGATGGCGCAGCAGCAATGCGTTATACTGAAGCGCGTATGACTAAAATCACACTTGAACTGTTACGTGATATTAATAAAGATACAATAGATTTTATCGATAACTATGATGGTAATGAAAGAGAGCCGTCAGTCTTACCTGCTCGATTCCCTAACTTGTTAGCCAATGGAGCATCAGGTATAGCGGTAGGTATGGCAACGAATATTCCACCACATAACTTAACAGAATTAATCAATGGTGTACTTAGCTTAAGTAAGAACCCTGATATTTCAATTGCTGAGTTAATGGAGGATATTGAAGGTCCTGATTTCCCAACTGCTGGACTTATTTTAGGTAAGAGTGGTATTAGACGTGCATATGAAACAGGTCGTGGTTCAATTCAAATGCGTTCTCGTGCAGTTATTGAAGAACGTGGAGGCGGACGTCAACGTATTGTTGTCACTGAAATTCCTTTCCAAGTGAATAAGGCTCGTATGATTGAAAAAATTGCAGAGCTCGTTCGTGACAAGAAAATTGACGGTATCACTGATTTACGTGATGAAACAAGTTTACGTACTGGTGTGCGTGTCGTTATTGATGTGCGTAAGGATGCAAATGCTAGTGTCATTTTAAATAACTTATACAAACAAACACCTCTTCAAACATCATTTGGTGTGAATATGATTGCACTTGTAAATGGTAGACCGAAGCTTATTAATTTAAAAGAAGCGTTGGTACATTATTTAGAGCATCAAAAGACAGTTGTTAGAAGACGTACGCAATACAACTTACGTAAAGCTAAAGATCGTGCCCACATTTTAGAAGGATTACGTATCGCACTTGACCATATCGATGAAATTATTTCAACGATTCGTGAGTCAGATACAGATAAAGTTGCAATGGAAAGCTTGCAACAACGCTTCAAACTTTCTGAAAAACAAGCTCAAGCTATTTTAGACATGCGTTTAAGACGTCTAACAGGTTTAGAGAGAGACAAAATTGAAGCTGAATATAATGAGTTATTAAATTATATTAGTGAATTAGAAACAATCTTAGCTGATGAAGAAGTATTACTACAATTAGTTAGAGATGAATTAACAGAAATTCGAGATCGTTTCGGTGATGATCGTCGTACTGAAATCCAATTAGGTGGATTTGAAGATTTAGAAGATGAAGATCTCATTCCAGAAGAACAAATTGTAATTACACTAAGCCATAATAACTACATTAAACGTTTGCCGGTATCTACATATCGTGCTCAAAACCGTGGTGGTCGTGGTGTTCAAGGTATGAATACATTGGAAGAAGATTTTGTCAGTCAATTGGTAACTTTAAGTACACATGACCATGTATTGTTCTTTACTAACAAAGGTCGTGTATACAAACTTAAAGGTTATGAAGTGCCTGAGTTATCAAGACAGTCTAAAGGTATTCCTGTAGTGAATGCTATTGAACTTGAAAATGATGAAGTCATTAGTACAATGATTGCTGTTAAAGACCTTGAAAGTGAAGACAACTTCTTAGTGTTTGCAACTAAACGTGGTGTCGTTAAACGTTCAGCATTAAGTAACTTCTCAAGAATAAATAGAAATGGTAAGATTGCGATTTCGTTCAGAGAAGATGATGAGTTAATTGCAGTTCGCTTAACAAGTGGTCAAGAAGATATCTTGATTGGTACATCACATGCATCATTAATTCGATTCCCTGAATCAACATTACGTCCTTTAGGCCGTACAGCAACGGGTGTGAAAGGTATTACACTTCGTGAAGGTGACGAAGTTGTAGGGCTTGATGTAGCTCATGCAAACAGTGTTGATGAAGTATTAGTAGTTACTGAAAATGGTTATGGTAAACGTACGCCAGTTAATGACTATCGTTTATCAAATCGTGGTGGTAAAGGTATTAAAACAGCTACGATTACTGAGCGTAATGGTAATGTTGTATGTATCACTACAGTAACTGGTGAAGAAGATTTAATGATTGTTACTAATGCAGGTGTCATTATTCGACTAGATGTTGCAGATATTTCTCAAAATGGTCGTGCAGCACAAGGTGTTCGCTTAATTCGCTTAGGTGATGATCAATTTGTTTCAACGGTTGCTAAAGTAAAAGAAGATGCAGAAGATGAAACGAATGAAGATGAGCAATCTACTTCAACTGTATCTGAAGATGGTACTGAACAACAACGTGAAGCGGTTGTAAATGATGAAACACCAGGAAATGCAATTCATACTGAAGTGATTGATTCAGAAGAAAATGATGAAGATGGACGTATTGAAGTAAGACAAGATTTCATGGATCGTGTTGAAGAAGATATACAACAATCATCAGATGAAGATGAAGAATAA
DNA gyrase subunit A8894.7402699624.5-0.458835.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, A subunitTIGR010631211.4DNA Metabolism / DNA replication / DNA topoisomerases, Type II, ATP-dependent / DNA gyrase subunit A (EC 5.99.1.3); Virulence, Disease and Defense / Resistance to antibiotics and toxic compounds / Resistance to fluoroquinolones / DNA gyrase subunit A (EC 5.99.1.3); Cell Division Subsystem including YidCD / DNA gyrase subunit A (EC 5.99.1.3)PF00521DNA_topoisoIVDNA gyrase/topoisomerase IV, subunit Ano clan definedno clan defined529.7
SA1244
CytoplasmicIntracellularno predicted signal peptide015925711Q99XG5NP_373244
MAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLGGFEDLEDEDLIPEEQIVITLSHNNYIKRLPVSTYRAQNRGGRGVQGMNTLEEDFVSQLVTLSTHDHVLFFTNKGRVYKLKGYEVPELSRQSKGIPVVNAIELENDEVISTMIAVKDLESEDNFLVFATKRGVVKRSALSNFSRINRNGKIAISFREDDELIAVRLTSGQEDILIGTSHASLIRFPESTLRPLGRTATGVKGITLREGDEVVGLDVAHANSVDEVLVVTENGYGKRTPVNDYRLSNRGGKGIKTATITERNGNVVCITTVTGEEDLMIVTNAGVIIRLDVADISQNGRAAQGVRLIRLGDDQFVSTVAKVKEDAEDETNEDEQSTSTVSEDGTEQQREAVVNDETPGNAIHTEVIDSEENDEDGRIEVRQDFMDRVEEDIQQSSDEDEE
no data available MicrobesOnline: SA0003 > SA0004 > SA0005 > SA000611952893; 20686482; 21166474
SA0007SA_RS00175S. aureus N315SAUPAN000013000nnrDCDSSA0007hypothetical proteinchromosome-976210592831no1122778NP_373245102271
ATGGGAGGTTATATCACTATGGAAACGTTAAATTCTATTAACATTCCTAAGCGTAAAGAAGATTCACATAAAGGTGATTATGGCAAAATTTTATTAATTGGTGGATCTGCTAACTTAGGTGGTGCCATTATGTTAGCGGCTCGTGCATGTGTATTTAGCGGTAGTGGTTTAATCACTGTAGCTACACATCCAACAAATCATTCAGCATTACATTCTCGTTGCCCAGAAGCGATGGTTATTGATATTAATGATACGAAAATGTTGACGAAAATGATTGAAATGACTGACAGTATACTAATTGGTCCAGGTCTTGGCGTTGATTTCAAAGGAAATAATGCCATTACATTCCTACTACAAAATATACAACCGCATCAAAATTTAATCGTAGACGGCGATGCGATTACAATCTTTAGTAAACTGAAACCGCAATTACCTACATGTCGTGTGATCTTTACTCCACACCTCAAAGAATGGGAACGATTAAGTGGTATTCCTATTGAGGAACAGACATATGAGCGTAATCGTGAAGCAGTTGATCGTTTAGGTGCAACTGTTGTACTTAAAAAACATGGTACTGAAATTTTCTTTAAAGATGAAGACTTTAAATTAACAATCGGTAGCCCAGCAATGGCGACTGGTGGTATGGGCGATACACTTGCTGGTATGATTACAAGTTTTGTCGGTCAATTTGATAACTTAAAAGAAGCGGTTATGAGTGCCACATATACACATAGTTTTATTGGCGAAAACCTTGCAAAAGATATGTATGTGGTACCACCATCAAGACTTATCAATGAAATACCTTACGCAATGAAACAATTAGAAAGTTAA
hypothetical protein2766.5121530171.7-0.03840584.2.1.136Unknown functionGeneralYjeF family C-terminal domainTIGR00196185.4ADP-dependent (S)-NAD(P)H-hydrate dehydratase (EC 4.2.1.136)PF01256Carb_kinaseCarbohydrate kinaseCL0118Ribokinase194.4no significant predictionIntracellularno predicted signal peptide015925712A0A0H3JKQ1NP_373245
MGGYITMETLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIMLAARACVFSGSGLITVATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQNIQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDRLGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSATYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
no data available
SA0008SA_RS00180S. aureus N315SAUPAN000014000hutHCDShutHhistidine ammonia-lyasechromosome+10900124141515no1122779NP_373246102272
ATGACTTTATATTTAGATGGTGAAACACTAACAATTGAGGATATTAAATCATTTTTACAACAACAATCAAAGATTGAAATTATTGATGATGCGTTAGAACGTGTCAAAAAAAGTAGAGCGGTAGTTGAACGTATTATTGAAAATGAGGAAACGGTTTACGGTATCACTACAGGTTTTGGGTTATTTAGTGATGTACGTATAGACCCGACGCAATATAATGAATTACAAGTGAATCTGATACGCTCACATGCCTGTGGACTAGGTGAGCCATTTTCAAAAGAAGTAGCATTAGTCATGATGATTTTACGATTGAATACATTATTAAAAGGTCATTCAGGTGCCACTTTAGAATTAGTGAGACAATTACAATTTTTTATAAATGAACGTATTATACCGATAATCCCACAACAAGGCTCTCTCGGTGCATCAGGAGATTTAGCGCCATTATCACATTTAGCATTAGCATTAATTGGTGAAGGGAAAGTATTGTACAGAGGGGAAGAAAAGGATAGTGACGATGTATTAAGAGAATTAAATAGACAACCTTTGAACCTTCAGGCTAAAGAGGGTTTAGCATTGATTAATGGTACGCAAGCTATGACAGCTCAAGGTGTCATTAGTTATATAGAAGCAGAAGATTTAGGTTACCAATCTGAATGGATTGCTGCATTAACGCATCAGTCTCTTAATGGCATTATAGATGCATATCGACATGATGTGCACTCTGTTCGTAATTTTCAAGAACAGATTAATGTGGCAGCGCGTATGCGTGATTGGTTAGAAGGATCAACATTAACGACGCGACAAGCAGAAATACGTGTACAAGATGCATATACGTTGCGTTGTATACCACAAATCCATGGCGCGAGTTTTCAAGTATTCAATTATGTTAAACAGCAATTAGAATTTGAAATGAATGCGGCTAATGATAATCCACTTATATTTGAGGAAGCAAATGAAACGTTTGTTATTTCAGGTGGTAACTTCCATGGACAACCTATTGCTTTTGCATTAGATCATCTTAAATTAGGTGTAAGTGAATTAGCAAACGTATCGGAACGTCGTCTAGAGCGACTAGTAAATCCTCAATTAAATGGTGATTTACCAGCATTTCTTAGTCCAGAGCCAGGATTGCAAAGTGGCGCGATGATTATGCAATATGCTGCTGCAAGTCTCGTTTCTGAAAATAAAACTTTAGCGCATCCAGCGAGTGTTGATTCTATCACTTCATCTGCGAACCAAGAAGATCACGTATCTATGGGAACTACAGCTGCTAGACATGGTTATCAAATTATTGAAAATGCAAGACGTGTGTTGGCAATCGAATGTGTTATTGCATTACAAGCAGCAGAGTTGAAAGGTGTCGAAGGATTATCACCAAAAACACGTCGTAAATATGAGGAGTTTCGAAGTATCGTGCCATCCATTACACATGACCGTCAATTTCATAAAGATATTGAAGCGGTTGCACAGTATTTAAAGCAATCAATTTATCAAACGACTGCATGTCACTAA
histidine ammonia-lyase5045.1492856089.2-0.1857144.3.1.3MetabolismEnergy metabolismAmino acids and amineshistidine ammonia-lyaseTIGR01225664.2Amino Acids and Derivatives / Histidine Metabolism / Histidine Degradation / Histidine ammonia-lyase (EC 4.3.1.3)PF00221Lyase_aromaticAromatic amino acid lyaseno clan definedno clan defined611.5CytoplasmicIntracellularno predicted signal peptide0161376701P64416NP_373246
MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERIIENEETVYGITTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRLNTLLKGHSGATLELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVLYRGEEKDSDDVLRELNRQPLNLQAKEGLALINGTQAMTAQGVISYIEAEDLGYQSEWIAALTHQSLNGIIDAYRHDVHSVRNFQEQINVAARMRDWLEGSTLTTRQAEIRVQDAYTLRCIPQIHGASFQVFNYVKQQLEFEMNAANDNPLIFEEANETFVISGGNFHGQPIAFALDHLKLGVSELANVSERRLERLVNPQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTLAHPASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKGVEGLSPKTRRKYEEFRSIVPSITHDRQFHKDIEAVAQYLKQSIYQTTACH
no data available no polycistronic organisation predictedSA1557 *1
SA0009SA_RS00185S. aureus N315SAUPAN000017000serSCDSserSseryl-tRNA synthetasechromosome+12793140791287yes1122780NP_373247102273
ATGTTAGACATTAGATTATTCAGAAATGAGCCTGACACAGTTAAGAGCAAAATTGAATTACGTGGAGATGATCCAAAAGTTGTAGATGAAATTTTAGAATTGGATGAGCAACGACGTAAATTAATTAGTGCAACAGAAGAAATGAAAGCACGTCGTAATAAAGTAAGCGAAGAAATCGCATTAAAAAAACGTAATAAAGAAAATGCTGATGATGTGATTGCTGAAATGCGCACATTAGGTGACGATATTAAAGAAAAAGATAGTCAATTAAATGAAATTGATAATAAAATGACAGGTATCCTTTGTCGTATTCCAAATTTAATAAGTGATGATGTACCTCAAGGTGAATCTGATGAAGATAACGTTGAAGTTAAAAAGTGGGGTACACCACGTGAGTTTTCATTTGAACCAAAAGCACATTGGGATATTGTAGAAGAATTGAAAATGGCTGATTTTGATCGTGCAGCAAAAGTTTCAGGTGCGCGTTTTGTATATTTAACAAATGAAGGTGCGCAATTAGAGCGTGCTTTAATGAACTATATGATTACAAAACATACAACACAACATGGTTATACAGAAATGATGGTACCACAGCTTGTGAACGCAGATACAATGTATGGTACAGGTCAATTACCTAAATTTGAAGAAGATTTATTTAAAGTAGAAAAAGAAGGATTATATACAATTCCAACTGCTGAAGTACCATTAACGAATTTCTACCGTAATGAAATTATTCAACCAGGTGTACTTCCTGAAAAATTCACTGGTCAATCTGCATGTTTCCGTAGTGAAGCAGGATCAGCAGGTAGAGATACAAGAGGATTAATTCGTTTACATCAATTCGATAAAGTGGAAATGGTACGTTTTGAACAACCTGAAGATTCATGGAATGCTTTAGAAGAAATGACAACAAATGCAGAAGCAATTCTAGAAGAGTTAGGTTTACCATACCGTCGTGTTATTTTATGTACAGGTGATATTGGATTTAGTGCAAGCAAAACATATGATATAGAAGTTTGGTTACCAAGCTACAATGATTATAAAGAAATTAGTTCATGCTCAAACTGTACGGATTTCCAAGCGCGTCGTGCTAACATCCGCTTCAAGCGTGACAAAGCAGCTAAACCAGAATTAGCACATACATTAAATGGTAGTGGTTTAGCAGTTGGACGTACATTTGCTGCTATTGTTGAAAATTACCAAAATGAAGATGGAACAGTAACAATTCCAGAAGCATTAGTACCATTTATGGGTGGTAAAACACAAATTTCAAAACCAGTTAAATAA
seryl-tRNA synthetase4284.7466548639.7-0.5850476.1.1.11Genetic information processingProtein synthesistRNA aminoacylationserine--tRNA ligaseTIGR00414571.6Amino Acids and Derivatives / Alanine, serine, and glycine / Glycine and Serine Utilization / Seryl-tRNA synthetase (EC 6.1.1.11); Protein Metabolism / Protein biosynthesis / tRNA aminoacylation, Ser / Seryl-tRNA synthetase (EC 6.1.1.11)PF00587tRNA-synt_2btRNA synthetase class II core domain (G, H, P, S and T)CL0040tRNA_synt_II115.4
SA0505; SA0506; SA0727; SA0943-1; SA0944; SA0945; SA0946; SA1099; SA1245; SA1409; SA1499; SA1520; SA1528; SA1984; SA2044; SA2428
CytoplasmicIntracellularno predicted signal peptide015925714P99178NP_373247
MLDIRLFRNEPDTVKSKIELRGDDPKVVDEILELDEQRRKLISATEEMKARRNKVSEEIALKKRNKENADDVIAEMRTLGDDIKEKDSQLNEIDNKMTGILCRIPNLISDDVPQGESDEDNVEVKKWGTPREFSFEPKAHWDIVEELKMADFDRAAKVSGARFVYLTNEGAQLERALMNYMITKHTTQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVEKEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRDTRGLIRLHQFDKVEMVRFEQPEDSWNALEEMTTNAEAILEELGLPYRRVILCTGDIGFSASKTYDIEVWLPSYNDYKEISSCSNCTDFQARRANIRFKRDKAAKPELAHTLNGSGLAVGRTFAAIVENYQNEDGTVTIPEALVPFMGGKTQISKPVK
no data available no polycistronic organisation predictedT-box(Ser) *115590099; 21166474
SA0010SA_RS00190S. aureus N315SAUPAN000018000-CDSSA0010hypothetical proteinchromosome+1473015425696no1122781NP_373248102274
ATGGCAACACATTTAAGTTTTAGACAAGGCGTACAAGAGTGTATCCCAACATTATTGGGTTATGCCGGTGTTGGTATTTCATTTGGTATTGTGGCTTCGTCTCAAAACTTTAGTATTTTAGAAATTATCTTGTTATGTCTTGTTATATATGCCGGTGCTGCGCAATTTATTATGTGCGCGTTGTTTATAGCAGGTACACCGATATCAGCGATTGTACTAACTGTATTTATCGTAAATTCAAGAATGTTCCTTTTAAGTATGTCGCTTGCACCAAACTTCAAGACATATGGGTTTTGGAACCGTGTTGGATTAGGTTCATTAGTAACTGACGAAACGTTTGGCGTCGCCATTACACCTTATTTAAAAGGAGAAGCTATCAATGATCGTTGGATGCATGGTCTTAATATCACAGCATATTTATTTTGGGCAATTTCATGTGTAGCTGGGGCTTTATTTGGCGAATATATCTCAAATCCGCAAACGCTAGGGTTAGATTTTGCTATCACGGCTATGTTTATCTTTTTGGCCATTGCGCAATTTGAATCAATTACTAAATCGCGATTAAGAATTTACATAGTACTCATTATTGCCGTCATAGTAATGATGTTATCGCTAAGTATGTTTATGCCTTCATATCTAGCAATATTAATTGCAGCCACAATTTCAGCAGCGTTAGGAGTGATGATGGAACGATGA
hypothetical protein2317.28388251591.05628MetabolismTransport and binding proteinsAmino acids, peptides and aminesazaleucine resistance protein AzlCTIGR0034690.1Branched-chain amino acid permeasePF03591AzlCAzlC proteinno clan definedno clan defined129Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide715925715A0A0H3JS51NP_373248
MATHLSFRQGVQECIPTLLGYAGVGISFGIVASSQNFSILEIILLCLVIYAGAAQFIMCALFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPYLKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQFESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMER
no data available MicrobesOnline: SA0010 > SAS001
SAS001SA_RS00195S. aureus N315SAUPAN000019000-CDSSAS001hypothetical proteinchromosome+1542215751330no1122782NP_373249102275
ATGATAACTCATATGAACATGTTAATACTTATTTTATTGTGTGGTATCGTAACGCTATTAATTCGAATTATACCTTTTATCATGATTTCAAAAGTGCAATTGCCTGATGTTGTGGTTCGATGGCTATCATTTATCCCAATCACACTATTTACGGCACTTGTCATTGACAGCATTATTCAACAGACGCCTCATGGTGAGGGGTATACATTAAACATCCCTTACATTATCGCGCTCATTCCGACGGTTATTTTATCTATAATCACGCGTAGTTTAACTATTACAATTATTAGTGGGATTGTTATCATGGCAACATTACGATTTTTCTTTTAA
hypothetical protein1099.2996112263.11.45229FIG01107951: hypothetical proteinPF05437AzlDBranched-chain amino acid transport protein (AzlD)no clan definedno clan defined82.6Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide415925716A0A0H3JK09NP_373249
MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQQTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMATLRFFF
no data available MicrobesOnline: SA0010 > SAS001
SA0011SA_RS00200S. aureus N315SAUPAN000021000metXCDSSA0011hypothetical proteinchromosome+1609317082990no1122783NP_373250102276
TTGTTTAAGGAGGAAAGAACAATGACAAATTACACAGTAGATACTTTAAATCTAGGGAAATTTATTACAGAATCTGGGGAAGTCATAGATAACTTGCGTTTGAGATATGAGCATGTTGGTTATCATGGACAACCATTAGTTGTAGTTTGTCATGCATTAACTGGCAATCATTTAACATATGGAACAGATGATTATCCGGGTTGGTGGCGAGAAATTATTGATGGGGGATATATACCCATTCACGATTATCAATTTTTAACATTTGATGTTATTGGTAGTCCTTTCGGTTCAAGTTCACCTTTAAACGACCCTCATTTTCCTAAAAAATTAACATTAAGAGATATAGTCAGAGCGAATGAACGAGGTATACAAGCCCTTGGTTATGATAAGATTAATATTTTAATAGGGGGAAGTCTTGGAGGTATGCAAGCAATGGAACTACTTTACAATCAACAGTTTGAAGTAGATAAAGCCATTATCCTTGCTGCAACAAGTCGAACATCATCTTATAGTAGAGCTTTCAATGAAATTGCAAGGCAAGCCATTCATCTTGGTGGTAAGGAAGGTCTAAGTATTGCACGCCAATTAGGTTTTTTGACATATCGATCATCAAAAAGTTATGATGAACGTTTCACGCCGGATGAAGTAGTCGCATACCAACAACATCAAGGTAATAAATTTAAAGAACATTTTGATTTGAATTGTTATCTGACACTGCTAGATGTATTGGATAGTCACAACATTGACCGAGGTCGCACAGACGTAACGCATATTTTTAAAAATTTAGAAACGAAAGTCTTAACGATGGGGTTCATAGATGATTTGCTATATCCGGACGATCAAGTTCGTGCATTAGGTGAACGTTTTAAATATCATCGTCATTTCTTCGTGCCTGATAATGTTGGACATGATGGATTCCTACTAAACTTTAGTACCTGGGCACCTAACTTATATCATTTCTTAAATTTAAAGCATTTTAAGCGTAAGTAA
hypothetical protein3296.8406437862.5-0.376596MetabolismAmino acid biosynthesisAspartate familyhomoserine O-acetyltransferaseTIGR01392200.8Amino Acids and Derivatives / Lysine, threonine, methionine, and cysteine / Methionine Biosynthesis / Homoserine O-acetyltransferase (EC 2.3.1.31)PF00561Abhydrolase_1alpha/beta hydrolase foldCL0028AB_hydrolase59.3CytoplasmicIntracellularno predicted signal peptide015925717A0A0H3JJ63NP_373250
MFKEERTMTNYTVDTLNLGKFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHIFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRK
no data available no polycistronic organisation predictedSA1098 *1; SAM *1
SA0012SA_RS00205S. aureus N315SAUPAN000023000-CDSSA0012hypothetical proteinchromosome+1731818313996no1122784NP_373251102277
ATCTATAAATTGTTAATTTCCATTAAAGAGGTTAAAATAATAGCTATAGTTAAAAATATGGGAGTGGCTTATGTGTTTTCAAAAATACAACCTAAAGCAACAATAATTGCAACGATTACGTTGGTATTTGTCGCTTTAGCTTTATATCTAGTGCCTGGTTTGGGACTAATATTTGCATTATTTGCAACCATACCAGGTATCGTTTTATGGAATAAATCAATACAATCTTTCGGGGTTAGTGCACTTATTACAGTAATTATAACAACTGTTTTAGGTAATACTTTCGTTTTAAGTGCCATCATATTAGTCTTAATTGCAAGTTTAATTATTGGTCAATTGCTCAAAGAAAGAACGTCTAAAGAAAGAATGTTATACGTAACAACAGTAGCGATGAGCTTAATTTCATTAATCGCTTTTATGTTACTACAAACATTCGGAAGGATTCCACCATCAGCGAGCATAGTAAAACCTTTCAAGCAAACATTACATGAAGCGATTACGATGAGCGGTGCCGATGCGAATATGACCCAAATATTAGAAGAAGGGTTTAGACAAGCGACCGTTCAATTACCAGGTTTCATCATTATCATTACATTTTTAATCGTCTTAATTAACTTAATCGTTACATTTCCGGTTTTACGAAAATTTAAAATCGCTACACCTGTATTTAAGCCACTTTTCGCGTGGCAAATGAGCGGTATTTTATTATGGATATACATTATTGTTATCATATGTTTATTATTTACAGGTCAACCGAGTGTGTTCCAGAGCATTCTTTTAAACTTCCAACTTGTGTTATCATTAGTAATGTATATTCAAGGTTTAAGTGTTATTCATTTCTTTGGTAAAGCGAAAGGTTTGCCGAATGCAGTAACGATTTTACTATTGATTATCGGTACAATACTGACACCTACGACACATATTGTAGGACTACTTGGTGTTATCGATTTAAGTTTGAATTTGAAGCGAATCATGAAAAATAATTCTAAAAAGTGA
hypothetical protein33110.865436381.41.11631CBSS-262719.3.peg.410 / FIG003573: hypothetical proteinPF09991DUF2232Predicted membrane protein (DUF2232)no clan definedno clan defined210.5Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide715925718A0A0H3JN26NP_373251
MYKLLISIKEVKIIAIVKNMGVAYVFSKIQPKATIIATITLVFVALALYLVPGLGLIFALFATIPGIVLWNKSIQSFGVSALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSKERMLYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILEEGFRQATVQLPGFIIIITFLIVLINLIVTFPVLRKFKIATPVFKPLFAWQMSGILLWIYIIVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLIIGTILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
no data available MicrobesOnline: SA0012 > SA0013 > SA0014 > SA0015
SA0013SA_RS00210S. aureus N315SAUPAN000024000-CDSSA0013hypothetical proteinchromosome+18328202951968no1122785NP_373252102278
ATGAATCGGCAGTCCACTAAGAAAGCTTTACTAATACCATTTGTCATCATGATCATCACAGCAATTGTTTTAATGGGTGTATGGTTTATCTTTAATAGTCTTATAGCATTAATTGCATCTATCGTTCTTGTCGTGATGATTATTGTTAGCATCATTTTATTCAGACAAGCTTTAATGAAAATGGATAGTTATGTAGATGGTTTGAGTGCTCAAATTTCAACAACAAATAATAAAGCAATCAAACATTTACCAATTGGTATCATTGTTTTAGATGAAAATGATCACATCGAATGGGTTAACCAATTTATGACAAATCATATGGAAGCAAATGTCATTTCTGAATCTGTAAATGAAGTATTTCCAAACATTTTAAAGCAATTAGATAGAGTGAAATCCGTTGAAATAGAATATAATCAGTATCATTTCCAAGTACGTTATTCTGAGAATGATCATTGCCTCTATTTCTTTGATATAACTGAACAAGTACAAACAAATGAACTATATGAAAATTCTAAACCAATCATTGCGACATTATTTTTAGATAACTACGATGAGATTACTCAAAATATGAATGATACGCAGCGTTCGGAAATCAATTCAATGGTAACGCGTGTTATTAGTCGATGGGCAACTGAGTATAATATATTCTTTAAAAGGTATAGTTCCGATCAATTCGTAGCCTATTTAAATCAAAAAATATTAGCTGACTTAGAAGAATCTAAATTTGATATCTTGAGTCAATTACGTGAAAAAAGTGTTGGTTATCGTGCCCAATTAACATTAAGTATTGGTGTTGGTGAAGGTACTGAAAATTTAATCGATTTAGGTGAATTATCACAATCAGGCCTAGACTTAGCATTAGGGCGCGGTGGCGACCAAGTTGCAATTAAAAGTATTAATGGTAATGTGCGTTTCTATGGCGGTAAGACTGACCCGATGGAGAAACGTACTCGTGTAAGAGCACGAGTGATCTCACATGCGTTAAAAGATATCCTTGCAGAGGGTGACAAAGTCATTATCATGGGACATAAACGTCCTGACTTAGATGCAATTGGTGCAGCAATCGGTGTGTCTAGATTTGCAATGATGAATAATTTAGAAGCATACATCGTATTAAATGAGACTGACATTGATCCAACATTACGACGCGTGATGAACGAAATTGATAAAAAGTCAGAGTTAAGAGAGCGATTTATAACATCAGATGATGCTTGGGATATGATGACATCTAAGACAACCGTAGTGATTGTTGATACGCATAAACCGGAACTGGTTTTAGATGAAAATGTCTTAAATAAAGCAAACCGTAAAGTTGTTATCGATCATCATAGACGTGGTGAAAGCTTCATCTCTAATCCATTGTTGATATATATGGAACCATACGCAAGTTCAACAGCTGAATTGGTAACAGAGTTACTGGAATATCAACCAACAGAACAACGTTTAACACGTCTTGAATCAACAGTGATGTATGCAGGTATTATTGTAGATACAAGAAACTTTACATTACGAACAGGATCAAGAACATTCGATGCAGCGAGTTATTTACGTGCACATGGTGCAGATACGATTTTAACGCAACATTTCTTAAAAGATGATGTGGATACTTACATTAATCGATCTGAATTAATTCGAACTGTAAAAGTTGAAGATAATGGCATAGCCATTGCGCATGGTTCAGACGATAAAATTTATCATCCAGTAACAGTTGCACAAGCAGCAGATGAACTGTTAAGTTTAGAAGGTATTGAAGCATCATATGTTGTTGCGAGACGTGAAGATAATCTGATTGGTATATCTGCGCGTTCACTCGGTTCAGTAAATGTTCAGTTAACAATGGAAGCACTTGGTGGCGGTGGACATTTAACCAATGCTGCAACACAACTTAAAGGTGTGACAGTCGAAGAGGCGATAGCACAATTACAACAAGCAATTACAGAACAATTAAGTAGGAGTGAAGATGCATGA
hypothetical protein6554.9442773769.6-0.109008Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR0296617.8CBSS-262719.3.peg.410 / Cyclic-di-AMP phosphodiesterase GdpPPF01368DHHDHH familyCL0137HAD79.1CytoplasmicMulti-transmembraneno predicted signal peptide215925719A0A0H3JKQ3NP_373252
MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMKMDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTNHMEANVISESVNEVFPNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFLDNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEESKFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSINGNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRFAMMNNLEAYIVLNETDIDPTLRRVMNEIDKKSELRERFITSDDAWDMMTSKTTVVIVDTHKPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQRLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINRSELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGISARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
no data available MicrobesOnline: SA0012 > SA0013 > SA0014 > SA0015
SA0014SA_RS00215S. aureus N315SAUPAN000025000rplICDSrplI50S ribosomal protein L9chromosome+2029220738447yes1122786NP_373253102279
ATGAAAGTAATTTTTACACAAGATGTTAAAGGTAAAGGTAAAAAAGGTGAAGTTAAAGAAGTACCAGTAGGTTATGCAAATAACTTCTTATTGAAAAAGAATTATGCTGTAGAAGCAACACCAGGTAACCTTAAACAATTAGAGTTACAGAAAAAACGTGCAAAACAAGAACGCCAACAAGAAATTGAAGATGCTAAAGCATTAAAAGAAACGTTATCAAACATTGAAGTTGAAGTATCAGCAAAAACTGGTGAAGGTGGTAAATTGTTTGGATCAGTAAGTACAAAACAAATTGCCGAAGCACTAAAAGCACAACATGATATTAAAATTGATAAACGTAAAATGGATTTACCAAATGGAATTCATTCCCTAGGATATACGAATGTACCTGTTAAATTAGATAAAGAAGTTGAAGGTACAATTCGCGTACACACAGTTGAACAATAA
50S ribosomal protein L914810.065416453.8-0.681757Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL9TIGR00158149.7Protein Metabolism / Protein biosynthesis / Ribosome LSU bacterial / LSU ribosomal protein L9p; CBSS-262719.3.peg.410 / LSU ribosomal protein L9pPF03948Ribosomal_L9_CRibosomal protein L9, C-terminal domainno clan definedno clan defined98.6
SA0422; SA0495; SA0497; SA0627; SA1520; SA2046
CytoplasmicIntracellularno predicted signal peptide015925720P66318NP_373253
MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
no data available MicrobesOnline: SA0012 > SA0013 > SA0014 > SA001511952893; 21166474
SA0015SA_RS00220S. aureus N315SAUPAN000026000dnaCCDSdnaCreplicative DNA helicasechromosome+20770221701401yes1122787NP_373254102280
ATGGATAGAATGTATGAGCAAAATCAAATGCCACATAACAATGAAGCTGAACAGTCTGTCTTAGGTTCAATTATTATAGATCCAGAATTGATTAATACTACTCAGGAAGTTTTGCTTCCTGAGTCGTTTTATAGGGGTGCCCATCAACATATTTTCCGTGCAATGATGCACTTAAATGAAGATAATAAAGAAATTGATGTTGTAACATTGATGGATCAATTATCGACGGAAGGTACGTTGAATGAAGCGGGTGGCCCGCAATATCTTGCAGAGTTATCTACAAATGTACCAACGACGCGAAATGTTCAGTATTATACTGATATCGTTTCTAAGCATGCATTAAAACGTAGATTGATTCAAACTGCAGATAGTATTGCCAATGATGGATATAATGATGAACTTGAACTAGATGCGATTTTAAGTGATGCAGAACGTCGAATTTTAGAGCTATCATCTTCTCGTGAAAGCGATGGCTTTAAAGACATTCGAGACGTCTTAGGACAAGTGTATGAAACAGCTGAAGAGCTTGATCAAAATAGTGGTCAAACACCAGGTATACCTACAGGATATCGAGATTTAGACCAAATGACAGCAGGGTTCAACCGAAATGATTTAATTATCCTTGCAGCGCGTCCATCTGTAGGTAAGACTGCGTTCGCACTTAATATTGCACAAAAAGTTGCAACGCATGAAGATATGTATACAGTTGGTATTTTCTCACTAGAGATGGGTGCTGATCAGTTAGCCACACGTATGATTTGTAGTTCTGGTAATGTTGACTCAAACCGCTTAAGAACGGGTACTATGACTGAGGAAGATTGGAGTCGTTTTACTATAGCGGTAGGTAAATTATCACGTACGAAGATTTTTATTGATGATACACCGGGTATTCGAATTAATGATTTACGTTCTAAATGTCGTCGATTAAAGCAAGAACATGGCTTAGACATGATTGTGATTGACTACTTACAGTTGATTCAAGGTAGTGGTTCACGTGCGTCCGATAACAGACAACAGGAAGTTTCTGAAATCTCTCGTACATTAAAAGCATTAGCCCGTGAATTAGAATGTCCAGTTATCGCATTAAGTCAGTTATCTCGTGGTGTTGAACAACGACAAGATAAACGTCCAATGATGAGTGATATTCGTGAATCTGGTTCGATTGAGCAAGATGCCGATATCGTTGCATTCTTATACCGTGATGATTACTATAACCGTGGCGGCGATGAAGATGATGACGATGATGGTGGTTTCGAGCCACAAACGAATGATGAAAACGGTGAAATTGAAATTATCATTGCTAAGCAACGTAACGGTCCAACAGGCACAGTTAAGTTACACTTTATGAAACAATATAATAAATTTACCGATATCGATTATGCACATGCAGATATGATGTAA
replicative DNA helicase4664.4176752571.3-0.5907733.6.4.12Genetic information processingDNA metabolismDNA replication, recombination, and repairreplicative DNA helicaseTIGR00665585.3CBSS-262719.3.peg.410 / Replicative DNA helicase (DnaB) (EC 3.6.4.12); DNA-replication / Replicative DNA helicase (DnaB) (EC 3.6.4.12)PF03796DnaB_CDnaB-like helicase C terminal domainCL0023P-loop_NTPase383.9
SA0627; SA1517; SA2031
CytoplasmicIntracellularno predicted signal peptide015925721A0A0H3JS55NP_373254
MDRMYEQNQMPHNNEAEQSVLGSIIIDPELINTTQEVLLPESFYRGAHQHIFRAMMHLNEDNKEIDVVTLMDQLSTEGTLNEAGGPQYLAELSTNVPTTRNVQYYTDIVSKHALKRRLIQTADSIANDGYNDELELDAILSDAERRILELSSSRESDGFKDIRDVLGQVYETAEELDQNSGQTPGIPTGYRDLDQMTAGFNRNDLIILAARPSVGKTAFALNIAQKVATHEDMYTVGIFSLEMGADQLATRMICSSGNVDSNRLRTGTMTEEDWSRFTIAVGKLSRTKIFIDDTPGIRINDLRSKCRRLKQEHGLDMIVIDYLQLIQGSGSRASDNRQQEVSEISRTLKALARELECPVIALSQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNRGGDEDDDDDGGFEPQTNDENGEIEIIIAKQRNGPTGTVKLHFMKQYNKFTDIDYAHADMM
no data available MicrobesOnline: SA0012 > SA0013 > SA0014 > SA001511952893; 18452509; 21166474
SA0016SA_RS00225S. aureus N315SAUPAN000028000purACDSpurAadenylosuccinate synthetasechromosome+22448237311284no1122788NP_373255102281
ATGTCATCAATCGTAGTAGTTGGGACACAATGGGGAGACGAAGGAAAAGGAAAAATAACGGATTTCTTGGCAGAACAGTCAGATGTTATCGCGCGTTTTTCAGGTGGTAATAATGCAGGCCATACCATTCAATTTGGCGGAGAAACATATAAATTACATTTAGTACCATCTGGTATCTTTTACAAAGACAAATTAGCGGTAATCGGTAACGGTGTCGTTGTTGATCCAGTTGCACTATTGAAAGAATTAGACGGATTAAATGAACGTGGCATTCCTACAAGTAATTTACGTATATCTAATCGTGCGCAAGTGATTTTACCATATCACTTAGCACAAGATGAATATGAAGAACGTTTACGCGGTGACAATAAGATTGGTACAACTAAAAAAGGTATCGGTCCAGCATATGTAGACAAAGTTCAACGTATCGGTATTCGTATGGCAGATTTACTTGAAAAAGAAACATTCGAAAGATTATTAAAATCAAACATTGAATATAAACAAGCATATTTCAAAGGTATGTTTAACGAAACATGTCCATCATTTGATGATATCTTTGAAGAATACTATGCTGCAGGTCAACGTTTAAAAGAATTTGTAACAGACACATCAAAAATCTTAGACGATGCATTTGTAGCAGATGAAAAGGTACTTTTCGAAGGTGCGCAAGGTGTAATGTTAGATATCGACCATGGTACATATCCATTCGTTACATCAAGTAATCCAATTGCAGGTAACGTTACTGTTGGTACAGGTGTAGGTCCTACATTCGTTTCGAAGGTAATTGGTGTATGTAAAGCTTATACATCACGTGTTGGTGATGGTCCATTCCCTACTGAATTATTCGATGAAGATGGACATCATATTAGAGAAGTTGGTCGTGAATACGGTACAACAACAGGACGTCCACGTCGTGTAGGTTGGTTTGACTCAGTTGTATTACGTCACTCTCGTCGTGTAAGTGGTATTACAGATTTATCTATTAACTCAATCGATGTTTTAACAGGCCTAGACACAGTGAAAATCTGTACAGCTTATGAATTAGACGGTAAAGAAATTACTGAGTACCCAGCAAACTTAGATCAATTAAAACGTTGTAAACCAATCTTTGAAGAGTTACCAGGTTGGACAGAAGACGTAACAAGTGTGCGTACTTTAGAAGAATTACCTGAAAATGCACGTAAATATTTAGAGCGTATTTCAGAATTATGTAATGTACAAATTTCTATCTTCTCAGTTGGTCCAGATAGAGAACAAACAAACCTATTAAAAGAATTGTGGTAG
adenylosuccinate synthetase4274.8564547551.4-0.3002346.3.4.4MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisadenylosuccinate synthaseTIGR00184594.6Miscellaneous / Miscellaneous - no subcategory / EC 6.3.4.- Ligases that form carbon-nitrogen bonds / Adenylosuccinate synthetase (EC 6.3.4.4); Nucleosides and Nucleotides / Purines / Purine conversions / Adenylosuccinate synthetase (EC 6.3.4.4); CBSS-262719.3.peg.410 / Adenylosuccinate synthetase (EC 6.3.4.4)PF00709Adenylsucc_syntAdenylosuccinate synthetaseCL0023P-loop_NTPase587.6
SA0014; SA0107; SA0218; SA0352; SA0354; SA0366; SA0372; SA0375; SA0471; SA0477; SA0495; SA0496; SA0497; SA0498; SA0501; SA0503; SA0504; SA0505; SA0506; SA0545; SA0587; SA0707; SA0727; SA0728; SA0729; SA0731; SA0759; SA0774; SA0802; SA0819; SA0823; SA0829; SA0869; SA0873; SA0934; SA0935; SA0943-1; SA0945; SA0946; SA0992; SA1029; SA1075; SA1081; SA1084; SA1099; SA1100; SA1116; SA1150; SA1170; SA1177; SA1184; SA1244; SA1255; SA1301; SA1305; SA1308; SA1342; SA1382; SA1409; SA1471; SA1473; SA1499; SA1502; SA1504; SA1510; SA1517; SA1520; SA1521; SA1524; SA1553; SA1599; SA1663; SA1709; SA1715; SA1716; SA1836; SA1914; SA1922; SA1927; SA1940; SA1959; SA1984; SA2017; SA2022; SA2023; SA2024; SA2025; SA2027; SA2029; SA2031; SA2032; SA2033; SA2034; SA2035; SA2036; SA2038; SA2041; SA2042; SA2043; SA2044; SA2045; SA2046; SA2047; SA2048; SA2204; SA2341; SA2356; SA2395; SA2399; SA2400; SAS052
CytoplasmicIntracellularno predicted signal peptide015925722P99099NP_373255
MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTSVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELW
no data available no polycistronic organisation predictedSA0454 *115590099; 21166474
SAtRNA01SA_RS00230S. aureus N315SAUPAN000029000trnaEtRNASAtRNA01tRNA-Gluchromosome+241602423475unknown11227892137100
GGCTCCTTGGTCAAGCGGTTAAGACACCGCCCTTTCACGGCGGTAACACGGGTTCGAGTCCCGTAGGAGTCACCA
tRNA-Glu0no predicted signal peptideno data available no polycistronic organisation predicted
SAtRNA02SA_RS00235S. aureus N315SAUPAN000030000trnaDtRNASAtRNA02tRNA-Aspchromosome+242422431473unknown11227902137101
GGTCTCGTAGTGTAGCGGTTAACACGCCTGCCTGTCACGCAGGAGATCGCGGGTTCGATTCCCGTCGAGACCG
tRNA-Asp0no predicted signal peptideno data available no polycistronic organisation predicted
SA0017SA_RS00240S. aureus N315SAUPAN000032000walRCDSvicRresponse regulatorchromosome+2492825635708no1122791NP_373256102282
ATGCAAATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTTAACTTAAAAAAAGAAGGATACGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGACTTAATTTATGAAGAAGAACCAGACATCGTATTACTAGATATCATGTTACCTGGTCGTGATGGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATAATAATGCTTACTGCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTAACGAAACCGTTTAGTACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCATTACTCACAACCAGCACAAGACACTGGAAATGTAACGAATGAAATCACAATTAAAGATATTGTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTAACACATCGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAACATTTATTACAAACAGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTAACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGTCACATCCTGAATATATTGTGACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG
response regulator2354.8121127451.1-0.478298Signal transductionRegulatory functions; Signal transductionDNA interactions; Two-component systemsphosphate regulon transcriptional regulatory protein PhoBTIGR02154235.8Iron acquisition and metabolism / Iron acquisition and metabolism - no subcategory / Heme, hemin uptake and utilization systems in GramPositives / Two-component response regulator SA14-24PF00072Response_regResponse regulator receiver domainCL0304CheY103.1
SA0422; SA0471; SA0945; SA1099; SA1308; SA1914; SA2041; SA2400
CytoplasmicIntracellularno predicted signal peptide015925723Q7A8E1NP_373256
MQMARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
no data available MicrobesOnline: SA0017 > SA0018 > SA0019 > SA0020; RegPrecise: SA0017 > SA0018SA1851 *114762013; 17827301; 21166474; 22825451
SA0018SA_RS00245S. aureus N315SAUPAN000033000walKCDSvicKtwo-component sensor histidine kinasechromosome+25648274741827no1122792NP_373257102283
ATGAAGTGGCTAAAACAACTACAATCCCTTCATACTAAACTTGTAATTGTTTATGTATTACTGATTATCATTGGTATGCAAATTATCGGGCTGTATTTTACAAATAATCTTGAAAAAGAGCTGCTTGATAATTTTAAGAAGAATATTACGCAGTACGCTAAACAATTAGAAATTAGTATTGAAAAAGTATATGACGAAAAGGGCTCCGTAAATGCACAAAAAGATATTCAAAATTTATTAAGTGAGTATGCCAACCGTCAAGAAATTGGAGAAATTCGTTTTATAGATAAAGACCAAATTATTATTGCGACGACGAAGCAGTCTAACCGTAGTCTAATCAATCAAAAAGCGAATGATAGTTCTGTCCAAAAAGCACTATCACTAGGACAATCAAACGATCATTTAATTTTAAAAGATTATGGCGGTGGTAAGGACCGTGTCTGGGTATATAATATCCCAGTTAAAGTCGATAAAAAGGTAATTGGTAATATTTATATCGAATCAAAAATTAATGACGTTTATAACCAATTAAATAATATAAATCAAATATTCATTGTTGGTACAGCTATTTCATTATTAATCACAGTCATCCTAGGATTCTTTATAGCGCGAACGATTACCAAACCAATCACCGATATGCGTAACCAGACGGTCGAAATGTCCAGAGGTAACTATACGCAACGTGTGAAGATTTATGGTAATGATGAAATTGGCGAATTAGCTTTAGCATTTAATAACTTGTCTAAACGTGTACAAGAAGCGCAGGCTAATACTGAAAGTGAGAAACGTAGACTGGACTCAGTTATCACCCATATGAGTGATGGTATTATTGCAACAGACCGCCGTGGACGTATTCGTATCGTCAATGATATGGCACTCAAGATGCTTGGTATGGCGAAAGAAGACATCATCGGATATTACATGTTAAGTGTATTAAGTCTTGAAGATGAATTTAAACTTGAAGAAATTCAAGAGAATAATGATAGTTTTTTATTAGATTTAAATGAAGAAGAAGGTCTAATCGCACGTGTTAACTTTAGTACGATTGTGCAGGAAACAGGATTTGTAACTGGTTATATCGCTGTGTTACATGACGTTACTGAACAACAACAAGTTGAACGTGAGCGTCGTGAATTTGTTGCCAATGTATCACATGAGTTACGTACACCTTTAACTTCTATGAATAGTTACATTGAAGCACTTGAAGAAGGTGCATGGAAAGATGAGGAACTTGCGCCACAATTTTTATCTGTTACCCGTGAAGAAACAGAACGAATGATTCGACTGGTCAATGACTTGCTACAGTTATCTAAAATGGATAATGAGTCTGATCAAATCAACAAAGAAATTATCGACTTTAACATGTTCATTAATAAAATTATTAATCGACATGAAATGTCTGCGAAAGACACAACATTTATTCGAGATATTCCGAAAAAGACGATTTTCACAGAATTTGATCCTGATAAAATGACGCAAGTATTCGATAATGTCATTACAAATGCGATGAAATATTCTAGAGGCGATAAACGTGTCGAGTTCCACGTGAAACAAAATCCACTTTATAATCGAATGACGATTCGTATTAAAGATAATGGCATCGGTATTCCTATCAATAAAGTCGATAAGATATTCGACCGATTCTATCGTGTAGATAAGGCACGTACGCGTAAAATGGGTGGTACTGGATTAGGACTAGCCATTTCGAAAGAGATTGTGGAAGCGCACAATGGTCGTATTTGGGCAAACAGTGTAGAAGGTCAAGGTACATCTATCTTTATCACACTTCCATGTGAAGTCATTGAAGACGGTGATTGGGATGAATAA
two-component sensor histidine kinase6085.3988369923.5-0.3537832.7.13.3Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR02966248Iron acquisition and metabolism / Iron acquisition and metabolism - no subcategory / Heme, hemin uptake and utilization systems in GramPositives / Two-component sensor kinase SA14-24PF02518HATPase_cHistidine kinase-, DNA gyrase B-, and HSP90-like ATPaseCL0025His_Kinase_A92.8
SA0017; SA1099; SA2031
Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide215925724Q7A8E0NP_373257
MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNINQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEVIEDGDWDE
no data available MicrobesOnline: SA0017 > SA0018 > SA0019 > SA0020; RegPrecise: SA0017 > SA0018SA1851 *114762013; 17827301; 21166474; 22825451
SA0019SA_RS00250S. aureus N315SAUPAN000034000walHCDSSA0019hypothetical proteinchromosome+27440288011362no1122793NP_373258102284
GTGAAGTCATTGAAGACGGTGATTGGGATGAATAATAAGGAACATATTAAATCTGTCATTTTAGCGCTACTCGTCTTGATGAGTGTCGTATTGACATATATGGTATGGAACTTTTCTCCTGATATTGCAAATGTCGACAATACAGATAGTAAGAAGAGTGAAACGAAACCTTTAACGACACCTATGACAGCCAAAATGGATACAACTATTACGCCATTTCAGATTATTCATTCGAAAAATGATCATCCAGAAGGTACGATTGCGACGGTATCTAATGTGAATAAACTGACGAAACCTTTGAAAAATAAAGAAGTGAAGTCCGTGGAACATGTTCGTCGTGATCATAACTTGATGATTCCGGATTTAAGCAGTGATTTTACATTATTCGATTTTACGTATGATTTACCGTTATCAACATATCTTGGCCAAGTACTGAACATGAATGCGAAAGTACCAAATCATTTCAATTTCAATCGTTTAGTCATAGATCATGATGCTGATGATAATATCGTGCTTTATGCTATAAGTAAAGACCGCCACGATTACGTAAAATTAACAACTACAACGAAAAATGATCATTTTTTAGATGCATTAGCAGCAGTGAAAAAAGATATGCAACCATACACAGATATCATCACAAACAAAGATACAATTGATCGTACGACGCATGTTTTTGCACCAAGTAAACCTGAAAAGTTAAAAACATATCGCATGGTATTTAACACGATTAGTGTTGAGAAAATGAATGCTATACTATTTGACGATTCAACCATCGTTCGTAGTTCAAAGAGTGGTGTTACAACCTACAACAATAATACAGGTGTCGCAAACTATAACGATAAAAATGAAAAATATCATTATAAAAACCTGTCCGAAGATGAAGCAAGTTCCAGCAAAATGGAAGAAACGATTCCAGGAACCTTTGATTTTATTAATGGTCATGGTGGTTTCTTAAACGAAGACTTCAGATTGTTTAGTACGAATAATCAGTCAGGCGAGTTAACATATCAACGTTTCCTTAACGGTTATCCAACGTTTAATAAAGAAGGCTCTAATCAAATTCAAGTCACTTGGGGTGAAAAAGGCGTCTTTGATTATCGTCGTTCGTTATTGCGCACCGACGTTGTGTTAAATAGTGAGGATAATAAAACGTTGCCGAAATTAGAGTCTGTACGTTCAAGCTTAGCGAACAATAGTGATATTAATTTTGAAAAAGTAACAAACATCGCTATCGGTTACGAAATGCAGGATAACTCAGATCATAATCACATTGAAGTGCAGATTAACAGTGAACTCGTACCGCGTTGGTATGTAGAATATGATGGTGAATGGTATGTTTATAACGATGGGAGGCTTGAATAA
hypothetical protein4536.0314651857.8-0.568653Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein CTIGR0171316.6CPO analysis / Two-component system YycFG regulatory protein YycHPF07435YycHYycH proteinCL0285YycI_YycH448.2no significant predictionN-terminally anchored (No CS)no predicted signal peptide115925725A0A0H3JK12NP_373258
MKSLKTVIGMNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTTPMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIPDLSSDFTLFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRHDYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVFNTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKMEETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGEKGVFDYRRSLLRTDVVLNSEDNKTLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSDHNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
no data available MicrobesOnline: SA0017 > SA0018 > SA0019 > SA002026999783
SA0020SA_RS00255S. aureus N315SAUPAN000035000walICDSSA0020hypothetical proteinchromosome+2880229590789no1122794NP_373259102285
ATGAACTGGAAACTGACAAAGACACTTTTCATTTTCGTGTTTATTCTTGTCAACATCGTGTTAGTATCGATTTATGTTAATAAAGTCAATCGCTCACACATTAATGAAGTTGAGAGTAACAATGAAGTTAATTTTCAGCAAGAAGAAATTAAAGTACCGGCTAGTATATTGAATAAATCAGTTAAAGGTATAAAATTAGAGCAAATTACAGGGCGATCAAAAGACTTTAGTTCTAAAGCTAAGGGCGATTCGGATTTGACCACATCAGATGGTGGAAAATTATTGAATGCGAACATTAGTCAATCGGTAAAGGTCAGTGACAATAACTTAAAAGATTTGAAAGATTATGTTAACAAACGTGTGTTCAAAGGTTCAGAATATCAATTAAGTGAAATTAATTCTGGTTCTGTAAAATACGAACAAACGTATGATAATTTCCCGATTTTGAACAATAGTAAAGCGATGTTGAACTTTAATATAGAAGATAACAAAGCGGCTAGTTATAAACAATCAATGATGGATGACATTAAGCCCACAGATGGTGCAGATAAGAAGCATCAAGTTATTGGAGTGAGAAAAGCAATCGAGGCATTATATTATAATCGTTACTTGAAAAAAGGTGATGAAGTCATTAATGCTAGACTCGGTTACTACTCAGTCGTGAACGAAACGAATGTTCAATTGTTACAACCAAACTGGGAAATTAAAGTGAAGCATGACGGTAAGGACAAAACGAATACTTACTATGTCGAAGCGACAAATAATAACCCTAAAATTATTAATCATTAA
hypothetical protein2629.6126329855.6-0.611069CPO analysis / Two-component system YycFG regulatory protein YycIPF09648YycIYycH proteinCL0285YycI_YycH171.4no significant predictionN-terminally anchored (No CS)no predicted signal peptide115925726A0A0H3JJ69NP_373259
MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPASILNKSVKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKRVFKGSEYQLSEINSGSVKYEQTYDNFPILNNSKAMLNFNIEDNKAASYKQSMMDDIKPTDGADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHDGKDKTNTYYVEATNNNPKIINH
no data available MicrobesOnline: SA0017 > SA0018 > SA0019 > SA002026999783
SA0021SA_RS00260S. aureus N315SAUPAN000036000walJCDSSA0021hypothetical proteinchromosome+2997930779801yes1122795NP_373260102286
ATGAGCCGCTTGATACGCATGAGTGTATTAGCAAGTGGTAGTACAGGTAACGCCACTTTTGTAGAAAATGAAAAAGGTAGTCTATTAGTTGATGTTGGTTTGACTGGCAAGAAAATGGAAGAATTGTTTAGTCAAATTGACCGTAATATTCAAGATTTAAATGGTATTTTAGTAACCCATGAACATATTGATCATATTAAAGGATTAGGTGTTTTGGCGCGTAAATATCAATTGCCAATTTATGCGAATGAAAAGACTTGGCAGGCAATTGAAAAGAAAGATAGTCGCATCCCTATGGATCAGAAATTCATTTTTAATCCTTATGAAACAAAATCTATTGCAGGTTTCGATGTTGAATCGTTTAACGTGTCACATGATGCAATAGATCCGCAATTTTATATTTTCCATAATAACTATAAGAAGTTTACGATTTTAACGGATACGGGTTACGTGTCTGATCGTATGAAAGGTATGATACGTGGCAGCGATGCGTTTATTTTTGAGAGTAATCATGACGTCGATATGTTGAGAATGTGTCGTTATCCATGGAAGACGAAACAACGTATTTTAGGCGATATGGGTCATGTATCTAATGAGGATGCGGGTCATGCGATGACAGATGTGATTACAGGTAACACGAAACGTATTTACCTATCGCATTTATCACAAGACAATAACATGAAAGATTTGGCGCGTATGAGTGTTGGCCAAGTATTGAACGAACACGATATTGATACGGAAAAAGAAGTATTGCTATGTGATACGGATAAAGCTATTCCAACGCCAATATATACAATATAA
hypothetical protein2666.3490430313.3-0.405639Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341333.4Heme, hemin uptake and utilization systems in GramPositives / Zn-dependent hydrolase YycJ/WalJ, required for cell wall metabolism and coordination of cell division with DNA replicationPF00753Lactamase_BMetallo-beta-lactamase superfamilyCL0381Metallo-HOrase80.1CytoplasmicIntracellularno predicted signal peptide015925727A0A0H3JN28NP_373260
MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTHEHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVESFNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCRYPWKTKQRILGDMGHVSNEDAGHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLNEHDIDTEKEVLLCDTDKAIPTPIYTI
no data available no polycistronic organisation predicted26999783
SA0022SA_RS00265S. aureus N315SAUPAN000037000adsACDSSA0022hypothetical proteinchromosome+31006333242319no1122796NP_373261102287
ATGAAAGCTTTATTACTTAAAACAAGTGTATGGCTCGTTTTGCTTTTTAGTGTGATGGGATTATGGCAAGTCTCGAACGCGGCTGAGCAGTATACACCAATCAAAGCACATGTAGTAACAACGATAGACAAAGCAACAACAGATAAGCAACAAGTAACGCCAACAAAGGAAGCGGCTCATCAATTTGGTGAAGAAGCGGCAACCAACGTATCAGCATCAGCACAGGGAACAGCTGATGAAATAAACAATAAAGTAACATCCAACGCATTTTCTAACAAACCATCTACAGCAGTTTCAACAAAAGTAAACGAAACGCACGATGTAGATACACAACAAGCCTCAACACAAAAACCAACTCAATCAGCAACATTCACATTATCAAATGCTAAAACAGCATCACTTTCACCACGAATGTTTGCTGCCAATGTACCACAAACAACAACACATAAAATATTACATACAAATGATATCCATGGCCGACTAGCCGAAGAAAAAGGGCGTGTCATCGGTATGGCTAAATTAAAAACAATAAAAGAACAAGAAAAGCCTGATTTAATGTTAGACGCAGGAGACGCCTTCCAAGGTTTACCACTTTCAAACCAGTCTAAAGGTGAAGAAATGGCTAAAGCAATGAATGCAGTAGGTTATGATGCTATGGCAGTGGGTAACCATGAATTTGACTTTGGATACGATCAGTTGAAAAAGTTAGAGGGTATGTTAGACTTCCCGATGCTAAGTACTAACGTTTACAAAGATGGGAAACGCGCGTTTAAGCCTTCAACAATTGTAACGAAAAATGGTATTCGTTATGGAATTATTGGCGTAACGACACCAGAAACAAAGACGAAAACAAGACCTGAGGGCATTAAAGGTGTTGAATTTAGAGATCCATTACAAAGTGTGACAGCAGAAATGATGCGTATTTATAAAGACGTAGATACATTTGTTGTTATATCACATTTAGGGATTGATCCTTCAACACAAGAAACATGGCGTGGTGATTACTTAGTGAAACAATTAAGTCAAAATCCACAATTGAAGAAACGTATTACAGTCATTGATGGTCATTCACATACCGTACTTCAAAATGGTCAAATTTATAACAATGATGCATTAGCACAAACAGGTACAGCACTTGCGAATATCGGTAAGGTTACATTTAATTACCGCAATGGAGAGGTATCAAATATTAAACCGTCATTGATTAATGTTAAAGACGTTGAAAATGTAACACCGAACAAAGCATTAGCTGAACAAATTAATCAAGCTGATCAAACATTTAGAGCACAAACAGCAGAGGTTATTATTCCAAATAATACCATTGATTTCAAAGGAGAAAGAGATGACGTTAGAACGCGTGAAACAAATTTAGGAAACGCGATTGCAGATGCTATGGAAGCGTATGGCGTTAAGAATTTCTCTAAAAAGACTGACTTTGCCGTGACAAATGGTGGAGGTATTCGTGCCTCTATCGCAAAAGGTAAGGTGACACGCTATGATTTAATCTCAGTATTACCATTTGGAAATACGATTGCGCAAATTGATGTAAAAGGTTCAGACGTCTGGACAGCTTTCGAACATAGTTTAGGTGCACCAACAACACAAAAAGACGGTAAGACAGTATTAACAGCGAATGGCGGTTTACTACATATCTCTGATTCAATTCGTGTTTACTATGATATGAATAAACCGTCTGGCAAACGAATTAACGCTATTCAAATTTTAAATAAAGAGACAGGTAAGTTTGAAAATATTGATTTAAAACGTGTATATCATGTAACGATGAATGACTTCACAGCATCAGGTGGCGACGGATATAGTATGTTCGGTGGCCCTAGAGAAGAAGGTATTTCATTAGATCAAGTACTAGCAAGTTATTTAAAAACAGCTAACATAGCTAAGTATGATACGACAGAACCACAACGTATGTTATTAGGTAAACCAGCAGTAAGTGAACAACCAGCTAAAGGACAACAAGGTAGCAAAGGTAGTGAGTCTGGTAAAGATGTACAACCAATTGGTGACGACAAAGCGATGAATCCAGCGAAACAACCAGCGACAGGTAAAGTTGTATTGTTACCAACGCATAGAGGAACTGTTAGTAGCGGTACAGAAGGTTCTGGTCGCACATTAGAAGGAGCTACTGTATCAAGCAAGAGTGGGAACCAATTGGTTAGAATGTCAGTGCCTAAAGGTAGCGCGCATGAGAAACAGTTACCAAAAACTGGAACTAATCAAAGCTCAAGCCCAGCAGCGATGTTTGTATTAGTAGCAGGTATAGGTTTAATCGCGACTGTACGACGTAGAAAAGCTAGTTAA
hypothetical protein7729.8240483497.9-0.448964MetabolismBiosynthesis of cofactors, prosthetic groups, and carriers; Transport and binding proteinsPyridine nucleotides; OtherNAD nucleotidaseTIGR01530135.2Nucleosides and Nucleotides / Purines / Purine conversions / 5'-nucleotidase (EC 3.1.3.5); Nucleosides and Nucleotides / Pyrimidines / pyrimidine conversions / 5'-nucleotidase (EC 3.1.3.5); Virulence, Disease and Defense / Adhesion / Adhesins in Staphylococcus / Virulence-associated cell-wall-anchored protein SasH (LPXTG motif)PF028725_nucleotid_C5'-nucleotidase, C-terminal domainno clan definedno clan defined141.2CellwallLPxTG Cell-wall anchoredsignal peptide predicted115925728A0A0H3JKQ6NP_373261
MKALLLKTSVWLVLLFSVMGLWQVSNAAEQYTPIKAHVVTTIDKATTDKQQVTPTKEAAHQFGEEAATNVSASAQGTADEINNKVTSNAFSNKPSTAVSTKVNETHDVDTQQASTQKPTQSATFTLSNAKTASLSPRMFAANVPQTTTHKILHTNDIHGRLAEEKGRVIGMAKLKTIKEQEKPDLMLDAGDAFQGLPLSNQSKGEEMAKAMNAVGYDAMAVGNHEFDFGYDQLKKLEGMLDFPMLSTNVYKDGKRAFKPSTIVTKNGIRYGIIGVTTPETKTKTRPEGIKGVEFRDPLQSVTAEMMRIYKDVDTFVVISHLGIDPSTQETWRGDYLVKQLSQNPQLKKRITVIDGHSHTVLQNGQIYNNDALAQTGTALANIGKVTFNYRNGEVSNIKPSLINVKDVENVTPNKALAEQINQADQTFRAQTAEVIIPNNTIDFKGERDDVRTRETNLGNAIADAMEAYGVKNFSKKTDFAVTNGGGIRASIAKGKVTRYDLISVLPFGNTIAQIDVKGSDVWTAFEHSLGAPTTQKDGKTVLTANGGLLHISDSIRVYYDMNKPSGKRINAIQILNKETGKFENIDLKRVYHVTMNDFTASGGDGYSMFGGPREEGISLDQVLASYLKTANIAKYDTTEPQRMLLGKPAVSEQPAKGQQGSKGSESGKDVQPIGDDKAMNPAKQPATGKVVLLPTHRGTVSSGTEGSGRTLEGATVSSKSGNQLVRMSVPKGSAHEKQLPKTGTNQSSSPAAMFVLVAGIGLIATVRRRKAS
no data available no polycistronic organisation predicted19808256; 22035583; 22088393
SA0023SA_RS00270S. aureus N315SAUPAN000040000orfXCDSorfXrRNA large subunit methyltransferasechromosome+3369234171480no1122797NP_373262102288
ATGAAAATCACCATTTTAGCTGTAGGGAAACTAAAAGAGAAATATTGGAAGCAAGCCATAGCAGAATATGAAAAACGTTTAGGCCCATACACCAAGATAGACATCATAGAAGTTCCAGACGAAAAAGCACCAGAAAATATGAGCGACAAAGAAATTGAGCAAGTAAAAGAAAAAGAAGGCCAACGAATACTAGCCAAAATTAAACCACAATCCACAGTCATTACATTAGAAATACAAGGAAAGATGCTATCTTCCGAAGGATTGGCCCAAGAATTGAACCAACGCATGACCCAAGGGCAAAGCGACTTTGTATTCGTCATTGGCGGATCAAACGGCCTGCACAAGGACGTCTTACAACGCAGTAACTACGCACTATCATTCAGCAAAATGACATTCCCACATCAAATGATGCGGGTTGTGTTAATTGAGCAAGTGTATAGAGCATTTAAGATTATGCGTGGAGAAGCATATCATAAATGA
rRNA large subunit methyltransferase1599.8588518306.2-0.4616352.1.1.177Genetic information processingProtein synthesistRNA and rRNA base modificationrRNA large subunit m3Psi methyltransferase RlmHTIGR00246186.6Ribosome biogenesis bacterial / 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase (EC 2.1.1.177)PF02590SPOUT_MTasePredicted SPOUT methyltransferaseCL0098SPOUT206.9CytoplasmicIntracellularno predicted signal peptide015925729P0A0N7NP_373262
MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
no data available no polycistronic organisation predicted
SA0024SA_RS00275S. aureus N315SAUPAN000041000-CDSSA0024hypothetical proteinchromosome+34454357491296no1122798NP_373263102289
ATGAGACATAATATATTTTATAATAGGAGGGAATTTCAAATGATAGACAACTTTATGCAGGTCCTTAAATTAATTAAAGAGAAACGTACCAATAATGTAGTTAAAAAATCTGATTGGGATAAAGGTGATCTATATAAAACTTTAGTCCATGATAAGTTACCCAAGCAGTTAAAAGTGCATATAAAAGAAGATAAATATTCAGTTGTAGGGAAGGTTGCTACTGGGAACTATAGTAAAGTTCCTTGGATTTCAATATATGATGAGAATATAACAAAAGAAACAAAGGATGGATATTATTTGGTATATCTTTTTCATCCGGAAGGAGAAGGCATATACTTATCTTTGAATCAAGGATGGTCAAAGATAAGTGATATGTTTCCGCGGGATAAAAATGCTGCAAAACAAAGAGCATTAACTTTATCTTCCGAACTCAATAAATATATTACATCAAATGAATTTAATACTGGAAGATTTTATTACGCAGAAAATAAAGATTCATCTTATGATTTAAAAAATGATTATCCATCAGGATATTCTCATGGATCAATAAGATTCAAATATTATGATTTGAATGAAGGATTCACAGAAGAAGATATGCTAGAGGATTTAAAGAAATTTTTAGAACTATTTAATGAATTAGCTTCAAAAGTTACAAAAACATCCTATGATAGCTTGGTCAATAGCATAGACGAAATACAGGAAGACAGCGAAATTGAAGAAATTAGAACAGCACAAAAAGATAAGACACTCAAGGAAGTGGAAGCACCTAAAGGAATAATTCCAAAATATAAAAAAGGTGTATCAAAGACTACTAAAAATGATTCAGAAATTGAAAAATCAAATAAAGAGAATAAATTAACCGGTAAAGTTGGAGAAAAATTAGCGCTAAATTACTTTAATGAGCTAATTGATAATAAAATAGACGAAGATAAGAAAGAACAGTTTAGGAATATTTTAAATGATAATCCAGGCTCTCAACACGGTCATGGCTATGATTTAGTAGCTTTTGATCCAACAAATACAGATAAAGCTGTAGAAAAATTTATTGAAATTAAAACATCTACATCTTCTAGTATTGAGGAACCATTTTTTATGTCGCTAAATGAAATGTTTGCTATGAAAGAATATAAGCAGAAATATTTAATATTAAGAATATTTAATGTTTCCGGTAAAGAACCACAATTTTATTTTATAGATCCATATGCAAATTATTCTGAATTTAAAGATGTAGATGATCTCATTGACAAAGTATTTAATGTAGAAGCTATTCAGTATAAAGTTTTTGGCGAAAAATGA
hypothetical protein4315.8062750435.4-0.798376FIG01108167: hypothetical proteinPF12102DUF3578Domain of unknown function (DUF3578)no clan definedno clan defined179no significant predictionIntracellularno predicted signal peptide015925730A0A0H3JS60NP_373263
MRHNIFYNRREFQMIDNFMQVLKLIKEKRTNNVVKKSDWDKGDLYKTLVHDKLPKQLKVHIKEDKYSVVGKVATGNYSKVPWISIYDENITKETKDGYYLVYLFHPEGEGIYLSLNQGWSKISDMFPRDKNAAKQRALTLSSELNKYITSNEFNTGRFYYAENKDSSYDLKNDYPSGYSHGSIRFKYYDLNEGFTEEDMLEDLKKFLELFNELASKVTKTSYDSLVNSIDEIQEDSEIEEIRTAQKDKTLKEVEAPKGIIPKYKKGVSKTTKNDSEIEKSNKENKLTGKVGEKLALNYFNELIDNKIDEDKKEQFRNILNDNPGSQHGHGYDLVAFDPTNTDKAVEKFIEIKTSTSSSIEEPFFMSLNEMFAMKEYKQKYLILRIFNVSGKEPQFYFIDPYANYSEFKDVDDLIDKVFNVEAIQYKVFGEK
no data available no polycistronic organisation predicted
SA0025SA_RS00280S. aureus N315SAUPAN000053000-CDSSA0025hypothetical proteinchromosome+3616436403240no1122799NP_373264102290
ATGAGTGATAATTTGTCATTATTCATTGACTATATCAATGATAATATAATCTATGGTAGTGAAATCAAACGGGAGAAATTAGAGAATTTATTTAATCAATTTGCTATAAAAAATGTTGAAAAGAACATTGTCTATGATGAACTGAAATCTTTAGATATTACAATCATTGAGTCACAGGATTCATATAAAAATAAATTGAAGAGATTATTTTCGGTTCTGTTGCAAAGTAAAAAAATATAG
hypothetical protein796.817089346.71-0.331646phenylacetic acid degradation protein paaNTIGR0228811.6hypothetical proteinPF17190RecG_NRecG N-terminal helical domainno clan definedno clan defined13.6no significant predictionIntracellularno predicted signal peptide015925731A0A0H3JK17NP_373264
MSDNLSLFIDYINDNIIYGSEIKREKLENLFNQFAIKNVEKNIVYDELKSLDITIIESQDSYKNKLKRLFSVLLQSKKI
no data available no polycistronic organisation predicted
SA0026SA_RS00285S. aureus N315SAUPAN000054000tnpCDSSA0026transposase for IS-like elementchromosome-3643537109675no1122800NP_373265102291
ATGAACTATTTCAGATATAAACAATTTAACAAGGATGTTATCACTGTAGCCGTTGGCTACTATCTAAGATATACATTGAGTTATCGTGATATATCTGAAATATTAAGGGAACGTGGTGTAAACGTTCATCATTCAACGGTCTACCGTTGGGTTCAAGAATATGCCCCAATTTTGTATCAAATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATCAAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATGCAGAGGGACATACATTAGATATTTGGTTGCGTAAGCAACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTCATTAAACAATTTGGTAAACCTCAAAAGGTAATTACAGATCAGGCACCTTCAACGAAGGTAGCAATGGCTAAAGTAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACATCGAAATATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGGTATCAAAGTATCAATACAGCAAAGAATACTTTAAAAGGTATTGAATGTATTTACGCTCTATATAAAAAGAACCGCAGGTCTCTTCAGATCTACGGATTTTCGCCATGCCACGAAATTAGCATCATGCTAGCAAGTTAA
transposase for IS-like element22410.42726915.2-0.601339Mobile element proteinPF13610DDE_Tnp_IS240DDE domainCL0219RNase_H133.2CytoplasmicIntracellularno predicted signal peptide015925732P0A044NP_373265
MNYFRYKQFNKDVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
no data available no polycistronic organisation predicted10348769
SA0027S. aureus N315SAUPAN000056000repBCDSSA0027hypothetical proteinchromosome-3720037406207no3251085NP_373266102292
TTGTCTGATTTGGAGGAAGGTTTACACCGTAAAAGGTTAATCTCCTATGGTGGTTTGTTAAAAGAAATACATAAAAAATTAAACCTTGATGACACAGAAGAAGGCGATTTGATTCATACAGATGATGACGAAAAAGCCGATGAAGATGGATTTTCTATTATTGCAATGTGGAATTGGGAACGGAAAAATTATTTTATTAAAGAGTAG
hypothetical protein684.432648065.92-0.936765Truncated replication protein for plasmidPF01446Rep_1Replication proteinCL0169Rep48no significant predictionIntracellularno predicted signal peptide015925733NP_373266
MSDLEEGLHRKRLISYGGLLKEIHKKLNLDDTEEGDLIHTDDDEKADEDGFSIIAMWNWERKNYFIKE
no data available MicrobesOnline: SA0027 < SA0028
SA0028SA_RS00295S. aureus N315SAUPAN000057000truncated repBCDSSA0028hypothetical proteinchromosome-3741038204795no1122801NP_373267102293
ATGGGGGTTTCTTTTAATATTATGTGTCCTAATAGTAGCATTTATTCAGATGAAAAATCAAGGGTTTTAGTGGACAAGACAAAAAGTGGAAAAGTGAGACCATGGAGAGAAAAGAAAATCGCTAATGTTGATTACTTTGAACTTCTGCATATTCTTGAATTTAAAAAGGCTGAAAGAGTAAAAGATTGTGCTGAAATATTAGAGTATAAACAAAATCGTGAAACAGGCGAAAGAAAGTTGTATCGAGTGTGGTTTTGTAAATCCAGGCTTTGTCCAATGTGCAACTGGAGGAGAGCAATGAAACATGGCATTCAGTCACAAAAGGTTGTTGCTGAAGTTATTAAACAAAAGCCAACAGTTCGTTGGTTGTTTCTCACATTAACAGTTAAAAATGTTTATGATGGCGAAGAATTAAATAAGAGTTTGTCAGATATGGCTCAAGGATTTCGCCGAATGATGCAATATAAAAAAATTAATAAAAATCTTGTTGGTTTTATGCGTGCAACGGAAGTGACAATAAATAATAAAGATAATTCTTATAATCAGCACATGCATGTATTGGTATGTGCGGAACCAACTTATTTTAAGAATACAGAAAACTGCGTGAATCAAAAACAATGGATTCAATTTTGGAAAAAGGCAATGAAATTAGACTATGATCCAAATGTAAAAGTTCAAATGATTCGACCGAAAAATAAATATAAATCGGATATACAATCGGCAATTGACGAAACTGCAAAATATCCTGTAAAGGATACGGATTTTATGACCGATGATGAAGAAAAGAATTTGTAA
hypothetical protein2649.9151331370.2-0.740152Truncated replication protein for pUB110 plasmidPF01446Rep_1Replication proteinCL0169Rep176.9CytoplasmicIntracellularno predicted signal peptide015925734NP_373267
MGVSFNIMCPNSSIYSDEKSRVLVDKTKSGKVRPWREKKIANVDYFELLHILEFKKAERVKDCAEILEYKQNRETGERKLYRVWFCKSRLCPMCNWRRAMKHGIQSQKVVAEVIKQKPTVRWLFLTLTVKNVYDGEELNKSLSDMAQGFRRMMQYKKINKNLVGFMRATEVTINNKDNSYNQHMHVLVCAEPTYFKNTENCVNQKQWIQFWKKAMKLDYDPNVKVQMIRPKNKYKSDIQSAIDETAKYPVKDTDFMTDDEEKNL
no data available MicrobesOnline: SA0027 < SA0028
SA0029SA_RS00300S. aureus N315SAUPAN000059000preCDSpreplasmid recombination enzymechromosome-38428396901263no1122803NP_373269102295
ATGAGTTATGCAGTTTGTAGAATGCAAAAAGTGAAATCAGCTGGACTAAAAGGCATGCAATTTCATAATCAAAGAGAGCGAAAAAGTAGAACGAATGATGATATTGACCATGAGCGAACACGTGAAAATTATGATTTGAAAAATGATAAAAATATTGATTACAACGAACGTGTCAAAGAAATTATTGAATCACAAAAAACAGGTACAAGAAAAACGAGGAAAGATGCTGTTCTTGTAAATGAGTTGCTAGTAACATCTGACCGAGATTTTTTTGAGCAACTGGATCCAGGAGAACAAAAACGATTTTTTGAGGAAAGTTATAAATTATTTTCCGAACGATATGGCAAGCAAAATATTGCTTATGCAACAGTTCATAATGATGAGCAAACCCCTCACATGCATTTAGGTGTTGTGCCTATGCGTGATGGAAAACTGCAAGGAAAAAATGTGTTTAATCGTCAAGAACTGTTATGGCTACAAGATAAATTCCCCGAGCATATGAAAAAACAGGGTTTTGAGTTGAAGCGTGGTGAACGTGGCTCTGACCGTAAACATATTGAGACAGCTAAATTTAAAAAACAAACTTTGGAAAAAGAGATTGATTTTCTAGAAAAAAATTTAGCAGTTAAAAAAGATGAATGGACTGCTTATAGCGATAAAGTTAAATCAGATTTAGAAGTACCAGCGAAACGACACATGAAAAGTGTTGAAGTGCCAACGGGTGAAAAGTCTATGTTTGGTTTGGGAAAAGAAATAATGAAAACAGAAAAGAAACCAACCAAAAATGTTGTTATATCGGAGCGTGATTATAAAAACTTAGTGACTGCTGCGAGAGATAACGATAGGTTAAAACAGCATGTTAGAAATCTCATGAGTACTGATATGGCGAGAGAATATAAAAAATTAAGTAAAGAACATGGGCAAGTTAAAGAAAAATATAGTGGTCTTGTAGAGCGATTTAATGAAAATGTAAATGATTATAATGAGTTGCTTGAAGAAAACAAGTCTTTAAAGTCTAAAATAAGCGATTTAAAGCGTGATGTGAGTTTAATCTATGAAAGCACTAAGGAATTCCTTAAGGAACGTACAGACGGCTTAAAAGCCTTTAAAAACGTTTTTAAGGGGTTTGTAGACAAGGTAAAGGATAAAACAGCACAATTCCAAGAAAAACACGATTTAGAACCTAAAAAGAACGAATTTGAACTAACTCATAACCGAGAGGTAAAAAAAGAACGAAGTCGAGATCAGGGAATGAGTTTATAA
plasmid recombination enzyme4209.9710249660-1.17738Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsintegrating conjugative element protein, PFL_4705 familyTIGR037525.8Plasmid recombination enzymePF01076Mob_PrePlasmid recombination enzymeCL0169Rep246.5no significant predictionIntracellularno predicted signal peptide015925736P0A0C6NP_373269
MSYAVCRMQKVKSAGLKGMQFHNQRERKSRTNDDIDHERTRENYDLKNDKNIDYNERVKEIIESQKTGTRKTRKDAVLVNELLVTSDRDFFEQLDPGEQKRFFEESYKLFSERYGKQNIAYATVHNDEQTPHMHLGVVPMRDGKLQGKNVFNRQELLWLQDKFPEHMKKQGFELKRGERGSDRKHIETAKFKKQTLEKEIDFLEKNLAVKKDEWTAYSDKVKSDLEVPAKRHMKSVEVPTGEKSMFGLGKEIMKTEKKPTKNVVISERDYKNLVTAARDNDRLKQHVRNLMSTDMAREYKKLSKEHGQVKEKYSGLVERFNENVNDYNELLEENKSLKSKISDLKRDVSLIYESTKEFLKERTDGLKAFKNVFKGFVDKVKDKTAQFQEKHDLEPKKNEFELTHNREVKKERSRDQGMSL
no data available no polycistronic organisation predicted10348769
SA0030S. aureus N315SAUPAN000089000-CDSSA0030hypothetical proteinchromosome+3979939939141no1122804NP_373270102296
GTGCTCTGCGAGGCTGTCGGCAGTGCCGACCAAAACCATAAAACCTTTAAGACCTTTCTTTTTTTTACGAGAAAAAAGAAACAAAAAAACCTGCCCTCTGCCACCTCAGCAAAGGGGGGTTTTGCTCTCGTGCTCGTTTAA
hypothetical protein4610.92065059.93-0.108696no significant predictionIntracellularno predicted signal peptide015925737A0A0H3JN30NP_373270
MLCEAVGSADQNHKTFKTFLFFTRKKKQKNLPSATSAKGGFALVLV
no data available no polycistronic organisation predicted
SA0031S. aureus N315SAUPAN000090000-CDSSA0031hypothetical proteinchromosome+3998740178192no1122805NP_373271102297
ATCTCCACCTTTAAACCCTTGCCAATTTTTATTTTGTCCGTTTTGTCTAGCTTACCGAAAGCCAGACTCAGCAAGAATAAAATTTTTATTGTCTTTCGGTTTTCTAGTGTAACGGACAAAACCACTCAAAATAAAAAAGATACAAGAGAGGTCTCTCGTATCTTTTATTCAGCAATCGCGCCCGATTGCTGA
hypothetical protein6310.93277183.440.0190476no significant predictionN-terminally anchored (No CS)no predicted signal peptide015925738A0A0H3JKQ9NP_373271
MSTFKPLPIFILSVLSSLPKARLSKNKIFIVFRFSSVTDKTTQNKKDTREVSRIFYSAIAPDC
no data available no polycistronic organisation predicted
SA0032SA_RS00305S. aureus N315SAUPAN000091000bleCDSbleObleomycin resistance proteinchromosome-4019740601405no1122806NP_373272102298
GTGAGAATGTTACAGTCTATCCCGGCATTGCCAGTCGGGGATATTAAAAAGAGTATAGGTTTTTATTGCGATAAACTAGGTTTCACTTTGGTTCACCATGAAGATGGATTCGCAGTTCTAATGTGTAATGAGGTTCGGATTCATCTATGGGAGGCAAGTGATGAAGGCTGGCGCTCTCGTAGTAATGATTCACCGGTTTGTACAGGTGCGGAGTCGTTTATTGCTGGTACTGCTAGTTGCCGCATTGAAGTAGAGGGAATTGATGAATTATATCAACATATTAAGCCTTTGGGCATTTTGCACCCCAATACATCATTAAAAGATCAGTGGTGGGATGAACGAGACTTTGCAGTAATTGATCCCGACAACAATTTGATTAGCTTTTTTCAACAAATAAAAAGCTAA
bleomycin resistance protein1344.7476515209.2-0.218657MetabolismEnergy metabolism; Central intermediary metabolismOther; Amino sugarslactoylglutathione lyaseTIGR0006816.9Bleomycin resistance proteinPF00903GlyoxalaseGlyoxalase/Bleomycin resistance protein/Dioxygenase superfamilyCL0104Glyoxalase38.1CytoplasmicIntracellularno predicted signal peptide015925739Q7A8D1NP_373272
MRMLQSIPALPVGDIKKSIGFYCDKLGFTLVHHEDGFAVLMCNEVRIHLWEASDEGWRSRSNDSPVCTGAESFIAGTASCRIEVEGIDELYQHIKPLGILHPNTSLKDQWWDERDFAVIDPDNNLISFFQQIKS
no data available no polycistronic organisation predicted10348769
SA0033SA_RS00310S. aureus N315SAUPAN000092000aadDCDSaadDkanamycin nucleotidyltransferasechromosome-4081841588771no1122807NP_373273102299
ATGAGAATAGTGAATGGACCAATAATAATGACTAGAGAAGAAAGAATGAAGATTGTTCATGAAATTAAGGAACGAATATTGGATAAATATGGGGATGATGTTAAGGCTATTGGTGTTTATGGCTCTCTTGGTCGTCAGACTGATGGGCCCTATTCGGATATTGAGATGATGTGTGTCATGTCAACAGAGGAAGCAGAGTTCAGCCATGAATGGACAACCGGTGAGTGGAAGGTGGAAGTGAATTTTGATAGCGAAGAGATTCTACTAGATTATGCATCTCAGGTGGAATCAGATTGGCCGCTTACACATGGTCAATTTTTCTCTATTTTGCCGATTTATGATTCAGGTGGATACTTAGAGAAAGTGTATCAAACTGCTAAATCGGTAGAAGCCCAAACGTTCCACGATGCGATTTGTGCCCTTATCGTAGAAGAGCTGTTTGAATATGCAGGCAAATGGCGTAATATTCGTGTGCAAGGACCGACAACATTTCTACCATCCTTGACTGTACAGGTAGCAATGGCAGGTGCCATGTTGATTGGTCTGCATCATCGCATCTGTTATACGACGAGCGCTTCGGTCTTAACTGAAGCAGTTAAGCAATCAGATCTTCCTTCAGGTTATGACCATCTGTGCCAGTTCGTAATGTCTGGTCAACTTTCCGACTCTGAGAAACTTCTGGAATCGCTAGAGAATTTCTGGAATGGGATTCAGGAGTGGACAGAACGACACGGATATATAGTGGATGTGTCAAAACGCATACCATTTTGA
kanamycin nucleotidyltransferase2564.4977629165.9-0.204688Kanamycin nucleotidyltransferase (EC 2.7.7.-)PF07827KNTase_CKNTase C-terminal domainCL0291KNTase_C121.8
SA0038; SA0218; SA0232; SA0424; SA0495; SA0498; SA0505; SA0506; SA0802; SA0943-1; SA1099; SA1271; SA1402; SA1517; SA1520; SA1528; SA1532; SA1716; SA1924; SA1938; SA1984; SA2016; SA2031; SA2035; SA2038; SA2041; SA2046; SA2048; SA2427
CytoplasmicIntracellularno predicted signal peptide015925740A0A0H3JS65NP_373273
MRIVNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHGQFFSILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLPSLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF
no data available no polycistronic organisation predicted21166474
SA0034SA_RS00315S. aureus N315SAUPAN000080000tnpCDSSA0034transposase for IS-like elementchromosome-4178142455675no1122808NP_373274102300
ATGAACTATTTCAGATATAAACAATTTAACAAGGATGTTATCACTGTAGCCGTTGGCTACTATCTAAGATATACATTGAGTTATCGTGATATATCTGAAATATTAAGGGAACGTGGTGTAAACGTTCATCATTCAACGGTCTACCGTTGGGTTCAAGAATATGCCCCAATTTTGTATCAAATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATCAAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATGCAGAGGGACATACATTAGATATTTGGTTGCGTAAGCAACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTCATTAAACAATTTGGTAAACCTCAAAAGGTAATTACAGATCAGGCACCTTCAACGAAGGTAGCAATGGCTAAAGTAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACATCGAAATATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGGTATCAAAGTATCAATACAGCAAAGAATACTTTAAAAGGTATTGAATGTATTTACGCTCTATATAAAAAGAACCGCAGGTCTCTTCAGATCTACGGATTTTCGCCATGCCACGAAATTAGCATCATGCTAGCAAGTTAA
transposase for IS-like element22410.42726915.2-0.601339Mobile element proteinPF13610DDE_Tnp_IS240DDE domainCL0219RNase_H133.2CytoplasmicIntracellularno predicted signal peptide015925741P0A044NP_373274
MNYFRYKQFNKDVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
no data available no polycistronic organisation predicted10348769
SA0035S. aureus N315SAUPAN000087000-CDSSA0035HMG-CoA synthasechromosome+4253942880342no1122809NP_373275102301
ATTTATACAGGATCATTATACTTAAGTTTAATTTCGTTATTACAGAACCACACATTCCAACCAGAAGAGAAAGTATGTCTATTTAGTTATGGTTCAGGAGCAGTAGGAGAAATCTTTAGTGGTTCAATCGTTAAAGGATATGACAAAGCATTAGATAAAGAGAAACACTTAAATATGCTAGAATCTAGAGAGCAATTATCAGTCGAAGAATACGAAACATTCTTTAACAGATTTGATAATCAAGAATTTGATTTCGAACGTGAATTGACACAAGATCCATATTCAAAAGTATACTTATACAGTATAGAAGACCATATCAGAACATATAAGATAGAGAAATAA
HMG-CoA synthase1134.5305413360.8-0.566372hydroxymethylglutaryl-CoA synthaseTIGR0183597.8Hydroxymethylglutaryl-CoA synthase N-domain homolog (EC 2.3.3.10)PF08540HMG_CoA_synt_CHydroxymethylglutaryl-coenzyme A synthase C terminalCL0046Thiolase39.7CytoplasmicIntracellularno predicted signal peptide015925742A0A0H3JK22NP_373275
MYTGSLYLSLISLLQNHTFQPEEKVCLFSYGSGAVGEIFSGSIVKGYDKALDKEKHLNMLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK
no data available no polycistronic organisation predicted
SA0036SA_RS00325S. aureus N315SAUPAN000099000ugpQCDSSA0036hypothetical proteinchromosome+4371744460744no1122810NP_3732762137102
ATGCTAACTGTATATGGACATAGAGGATTACCTAGTAAAGCTCCGGAAAATACAATTGCATCATTTAAAGCTGCTTCAGAAGTAGAAGGTATAAACTGGTTGGAGTTAGATGTTGCAATTACAAAAGATGAACAACTGATTATCATTCATGATGATTATTTAGAACGGACTACAAATATGTCCGGGGAAATAACTGAATTGAATTATGATGAAATTAAAGATGCTTCTGCAGGATCTTGGTTTGGTGAAAAATTCAAAGATGAACATTTGCCAACTTTCGATGATGTAGTAAAAATAGCAAATGAATATAATATGAATTTAAATGTAGAATTAAAAGGTATTACTGGACCGAATGGACTAGCACTTTCTAAAAGTATGGTTAAGCAAGTGGAAGAACAATTAACAAACTTAAATCAGAATCAAGAAGTGCTCATTTCAAGCTTTAATGTTGTGCTTGTTAAACTTGCAGAAGAAATCATGCCACAATATAACAGAGCAGTTATATTCCATACAACTTCGTTTCGTGAAGACTGGAGAACACTTTTAGATTACTGTAATGCTAAAATAGTAAACACTGAAGATGCCAAACTTACTAAAGCAAAAGTAAAAATGGTAAAAGAAGCGGGTTATGAATTGAACGTATGGACTGTAAACAAACCAGCACGTGCAAACCAACTTGCTAATTGGGGAGTTGATGGTATCTTTACAGACAATGCAGATAAAATGGTGCATTTGTCTCAATAG
hypothetical protein2474.6584827899.4-0.346559MetabolismEnergy metabolismMethanogenesistetrahydromethanopterin S-methyltransferase, subunit BTIGR0416612.4Carbohydrates / Sugar alcohols / Glycerol and Glycerol-3-phosphate Uptake and Utilization / Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)PF03009GDPDGlycerophosphoryl diester phosphodiesterase familyCL0384PLC151.9CytoplasmicIntracellularno predicted signal peptide029165616A0A0H3JJ79NP_373276
MLTVYGHRGLPSKAPENTIASFKAASEVEGINWLELDVAITKDEQLIIIHDDYLERTTNMSGEITELNYDEIKDASAGSWFGEKFKDEHLPTFDDVVKIANEYNMNLNVELKGITGPNGLALSKSMVKQVEEQLTNLNQNQEVLISSFNVVLVKLAEEIMPQYNRAVIFHTTSFREDWRTLLDYCNAKIVNTEDAKLTKAKVKMVKEAGYELNVWTVNKPARANQLANWGVDGIFTDNADKMVHLSQ
no data available MicrobesOnline: SA0036 > SA0037
SA0037SA_RS00330S. aureus N315SAUPAN000100000maoCCDSSA0037hypothetical proteinchromosome+4455744985429no1122811NP_373277102303
ATGAAATACGATGATTTTATAGTAGGAGAAACATTCAAAACAAAAAGCCTTCATATTACAGAAGAAGAAATTATCCAATTTGCAACAACTTTTGATCCTCAATATATGCATATAGATAAAGAAAAAGCAGAACAAAGTAGATTTAAAGGTATCATTGCATCTGGCATGCATACACTTTCAATATCATTTAAATTATGGGTAGAAGAAGGTAAATACGGAGAAGAAGTTGTAGCAGGAACACAAATGAATAACGTTAAATTTATTAAACCTGTATACCCAGGTAATACATTGTACGTTATCGCTGAAATTACAAATAAGAAATCCATAAAAAAAGAAAATGGACTCGTTACAGTGTCACTTTCAACATACAATGAAAATGAAGAAATTGTATTTAAGGGAGAAGTAACAGCACTTATTAATAATTCATAA
hypothetical protein1425.280316136.3-0.311268phenylacetic acid degradation protein paaNTIGR0227860.4MaoC domain proteinPF01575MaoC_dehydratasMaoC like domainCL0050HotDog112.9no significant predictionIntracellularno predicted signal peptide015925744A0A0H3JN34NP_373277
MKYDDFIVGETFKTKSLHITEEEIIQFATTFDPQYMHIDKEKAEQSRFKGIIASGMHTLSISFKLWVEEGKYGEEVVAGTQMNNVKFIKPVYPGNTLYVIAEITNKKSIKKENGLVTVSLSTYNENEEIVFKGEVTALINNS
no data available MicrobesOnline: SA0036 > SA0037
SA0038SA_RS00335S. aureus N315SAUPAN000101000mecACDSmecApenicillin binding protein 2 primechromosome-45031470372007no1122812NP_373278102304
ATGAAAAAGATAAAAATTGTTCCACTTATTTTAATAGTTGTAGTTGTCGGGTTTGGTATATATTTTTATGCTTCCAAAGATAAAGAAATTAATAATACTATTGATGCAATTGAAGATAAAAATTTCAAACAAGTTTATAAAGATAGCAGTTATATTTCTAAAAGCGATAATGGTGAAGTAGAAATGACTGAACGTCCGATAAAAATATATAATAGTTTAGGCGTTAAAGATATAAACATTCAGGATCGTAAAATAAAAAAAGTATCTAAAAATAAAAAACGAGTAGATGCTCAATATAAAATTAAAACAAACTACGGTAACATTGATCGCAACGTTCAATTTAATTTTGTTAAAGAAGATGGTATGTGGAAGTTAGATTGGGATCATAGCGTCATTATTCCAGGAATGCAGAAAGACCAAAGCATACATATTGAAAATTTAAAATCAGAACGTGGTAAAATTTTAGACCGAAACAATGTGGAATTGGCCAATACAGGAACAGCATATGAGATAGGCATCGTTCCAAAGAATGTATCTAAAAAAGATTATAAAGCAATCGCTAAAGAACTAAGTATTTCTGAAGACTATATCAAACAACAAATGGATCAAAATTGGGTACAAGATGATACCTTCGTTCCACTTAAAACCGTTAAAAAAATGGATGAATATTTAAGTGATTTCGCAAAAAAATTTCATCTTACAACTAATGAAACAGAAAGTCGTAACTATCCTCTAGGAAAAGCGACTTCACATCTATTAGGTTATGTTGGTCCCATTAACTCTGAAGAATTAAAACAAAAAGAATATAAAGGCTATAAAGATGATGCAGTTATTGGTAAAAAGGGACTCGAAAAACTTTACGATAAAAAGCTCCAACATGAAGATGGCTATCGTGTCACAATCGTTGACGATAATAGCAATACAATCGCACATACATTAATAGAGAAAAAGAAAAAAGATGGCAAAGATATTCAACTAACTATTGATGCTAAAGTTCAAAAGAGTATTTATAACAACATGAAAAATGATTATGGCTCAGGTACTGCTATCCACCCTCAAACAGGTGAATTATTAGCACTTGTAAGCACACCTTCATATGACGTCTATCCATTTATGTATGGCATGAGTAACGAAGAATATAATAAATTAACCGAAGATAAAAAAGAACCTCTGCTCAACAAGTTCCAGATTACAACTTCACCAGGTTCAACTCAAAAAATATTAACAGCAATGATTGGGTTAAATAACAAAACATTAGACGATAAAACAAGTTATAAAATCGATGGTAAAGGTTGGCAAAAAGATAAATCTTGGGGTGGTTACAACGTTACAAGATATGAAGTGGTAAATGGTAATATCGACTTAAAACAAGCAATAGAATCATCAGATAACATTTTCTTTGCTAGAGTAGCACTCGAATTAGGCAGTAAGAAATTTGAAAAAGGCATGAAAAAACTAGGTGTTGGTGAAGATATACCAAGTGATTATCCATTTTATAATGCTCAAATTTCAAACAAAAATTTAGATAATGAAATATTATTAGCTGATTCAGGTTACGGACAAGGTGAAATACTGATTAACCCAGTACAGATCCTTTCAATCTATAGCGCATTAGAAAATAATGGCAATATTAACGCACCTCACTTATTAAAAGACACGAAAAACAAAGTTTGGAAGAAAAATATTATTTCCAAAGAAAATATCAATCTATTAACTGATGGTATGCAACAAGTCGTAAATAAAACACATAAAGAAGATATTTATAGATCTTATGCAAACTTAATTGGCAAATCCGGTACTGCAGAACTCAAAATGAAACAAGGAGAAACTGGCAGACAAATTGGGTGGTTTATATCATATGATAAAGATAATCCAAACATGATGATGGCTATTAATGTTAAAGATGTACAAGATAAAGGAATGGCTAGCTACAATGCCAAAATCTCAGGTAAAGTGTATGATGAGCTATATGAGAACGGTAATAAAAAATACGATATAGATGAATAA
penicillin binding protein 2 prime6689.1923476102-0.708234Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanpenicillin-binding protein 2TIGR03423306.2Cell Wall and Capsule / Cell Wall and Capsule - no subcategory / Peptidoglycan Biosynthesis / Penicillin-binding protein PBP2a, methicillin resistance determinant MecA, transpeptidasePF00905TranspeptidasePenicillin binding protein transpeptidase domainCL0013Beta-lactamase239.9
SA0295; SA2016
Cytoplasmic MembraneN-terminally anchored (No CS)no predicted signal peptide115925745A0A0H3JKR2NP_373278
MKKIKIVPLILIVVVVGFGIYFYASKDKEINNTIDAIEDKNFKQVYKDSSYISKSDNGEVEMTERPIKIYNSLGVKDINIQDRKIKKVSKNKKRVDAQYKIKTNYGNIDRNVQFNFVKEDGMWKLDWDHSVIIPGMQKDQSIHIENLKSERGKILDRNNVELANTGTAYEIGIVPKNVSKKDYKAIAKELSISEDYIKQQMDQNWVQDDTFVPLKTVKKMDEYLSDFAKKFHLTTNETESRNYPLGKATSHLLGYVGPINSEELKQKEYKGYKDDAVIGKKGLEKLYDKKLQHEDGYRVTIVDDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNMKNDYGSGTAIHPQTGELLALVSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKILTAMIGLNNKTLDDKTSYKIDGKGWQKDKSWGGYNVTRYEVVNGNIDLKQAIESSDNIFFARVALELGSKKFEKGMKKLGVGEDIPSDYPFYNAQISNKNLDNEILLADSGYGQGEILINPVQILSIYSALENNGNINAPHLLKDTKNKVWKKNIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAELKMKQGETGRQIGWFISYDKDNPNMMMAINVKDVQDKGMASYNAKISGKVYDELYENGNKKYDIDE
no data available no polycistronic organisation predictedSA0040 *121166474
SA0039SA_RS00340S. aureus N315SAUPAN000102000mecR1CDSmecR1methicillin resistance proteinchromosome+47137488941758no1122813NP_373279102305
GTGTTATCATCTTTTTTAATGTTAAGTATAATCAGTTCATTGCTCACGATATGTGTAATTTTTTTAGTGAGAATGCTCTATATAAAATATACTCAAAATATTATGTCACATAAGATTTGGTTATTAGTGCTCGTCTCCACGTTAATTCCATTAATACCATTTTACAAAATATCGAATTTTACATTTTCAAAAGATATGATGAATCGAAATGTATCTGACACGACTTCTTCGGTTAGTCATATGTTAGATGGTCAACAATCATCTGTTACGAAAGACTTAGCAATTAATGTTAATCAGTTTGAGACCTCAAATATAACGTATATGATTCTTTTGATATGGGTATTTGGTAGTTTGTTGTGCTTATTTTATATGATTAAGGCATTCCGACAAATTGATGTTATTAAAAGTTCGTCATTGGAATCGTCATATCTTAATGAACGACTTAAAGTATGTCAAAGTAAGATGCAGTTCTACAAAAAGCATATAACAATTAGTTATAGTTCAAACATTGATAATCCGATGGTATTTGGTTTAGTGAAATCCCAAATTGTACTACCAACTGTCGTAGTCGAAACCATGAATGACAAAGAAATTGAATATATTATTCTACATGAACTATCACATGTGAAAAGTCATGACTTAATATTCAACCAGCTTTATGTTGTTTTTAAAATGATATTCTGGTTTAATCCTGCACTATATATAAGTAAAACAATGATGGACAATGACTGTGAAAAAGTATGTGATAGAAACGTTTTAAAAATTTTGAATCGCCATGAACATATACGTTATGGTGAATCGATATTAAAATGCTCTATTTTAAAATCTCAGCACATAAATAATGTGGCAGCACAATATTTACTAGGTTTTAATTCAAATATTAAAGAACGTGTTAAGTATATTGCACTTTATGATTCAATGCCTAAACCTAATCGAAACAAGCGTATTGTTGCGTATATTGTATGTAGTATATCGCTTTTAATACAAGCACCGTTACTATCTGCACATGTTCAACAAGACAAATATGAAACAAATGTATCATATAAAAAATTAAATCAACTAGCTCCGTATTTCAAAGGATTTGATGGAAGTTTTGTGCTTTATAATGAACGGGAGCAAGCTTATTCTATTTATAATGAACCAGAAAGTAAACAACGATATTCACCTAATTCTACTTACAAAATTTATTTAGCGTTAATGGCATTCGACCAAAATTTACTCTCATTAAATCATACTGAACAACAATGGGATAAACATCAATATCCATTTAAAGAATGGAACCAAGATCAAAATTTAAATTCTTCAATGAAATATTCAGTAAATTGGTATTACGAAAATTTAAACAAACATTTAAGACAAGATGAGGTTAAATCTTATTTAGATCTAATTGAATATGGTAATGAAGAAATATCAGGGAATGAAAATTATTGGAATGAATCTTCATTAAAAATTTCTGCAATAGAACAGGTTAATTTGTTGAAAAATATGAAACAACATAACATGCATTTTGATAATAAGGCTATTGAAAAAGTTGAAAATAGTATGACTTTGAAACAAAAAGATACTTATAAATATGTAGGTAAAACTGGAACAGGAATCGTGAATCACAAAGAAGCAAATGGATGGTTCGTAGGTTATGTTGAAACGAAAGATAATACGTATTATTTTGCTACACATTTAAAAGGCGAAGACAATGCGAATGGCGAAAAAGCACAACAAATTTCTGAGCGTATTTTAAAAGAAATGGAGTTAATATAA
methicillin resistance protein5858.5098768502.5-0.275043Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanpenicillin-binding protein 2TIGR0342323.9Methicillin resistance regulatory sensor-transducer MecR1PF05569Peptidase_M56BlaR1 peptidase M56CL0126Peptidase_MA335.8Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide415925746P0A0B0NP_373279
MLSSFLMLSIISSLLTICVIFLVRMLYIKYTQNIMSHKIWLLVLVSTLIPLIPFYKISNFTFSKDMMNRNVSDTTSSVSHMLDGQQSSVTKDLAINVNQFETSNITYMILLIWVFGSLLCLFYMIKAFRQIDVIKSSSLESSYLNERLKVCQSKMQFYKKHITISYSSNIDNPMVFGLVKSQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMMDNDCEKVCDRNVLKILNRHEHIRYGESILKCSILKSQHINNVAAQYLLGFNSNIKERVKYIALYDSMPKPNRNKRIVAYIVCSISLLIQAPLLSAHVQQDKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEANGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI
no data available MicrobesOnline: SA0039 > SA0040; RegPrecise: SA0039 > SA0040SA0040 *11544435; 16846613
SA0040SA_RS00345S. aureus N315SAUPAN000104000mecICDSmecImethicillin resistance regulatory proteinchromosome+4889449265372no1122814NP_373280102306
ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGGATGAAAAAATATGCAAGTGCGAATAATATAATAGAAGAAATACAAATGCAAAAGGACTGGAGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATAAAAAGGGATTTATAGATCGTAAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATATAAAACATCTAAAAACTTTATCAATAAAGTATACAAAGGCGGTTTCAATTCACTTGTCTTAAACTTTGTAGAAAAAGAAGATCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTGAATAAAAAATAA
methicillin resistance regulatory protein1239.4658914789.9-0.74065Metabolism; Signal transductionTransport and binding proteins; Regulatory functionsCations and iron carrying compounds; DNA interactionscopper transport repressor, CopY/TcrY familyTIGR02698102.1Methicillin resistance repressor MecIPF03965Penicillinase_RPenicillinase repressorCL0123HTH130.6no significant predictionIntracellularno predicted signal peptide015925747P68261NP_373280
MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
no data available MicrobesOnline: SA0039 > SA0040; RegPrecise: SA0039 > SA0040SA0040 *110348769; 12881514; 14960592; 1544435; 15716455; 16582476
SA0041SA_RS00350S. aureus N315SAUPAN000106000xylRCDSxylRhypothetical proteinchromosome+49752508821131no1122815NP_373281102307
ATAAATGATAATGAAAAAAGAGTGCTAAGGGAAATTTATAACCATCATAATATTTCGCGTACTCAAATATCTAAAAATCTTGAGATTAATAAGGCAACGATTTCTAGTATTTTGAATAAGTTAAAGTATAAATCTCTTGTTAATGAGGTTGGTGAGGGTGATAGCACGAAGAGTGGTGGTAGAAAACCTATTCTTCTGAAGGTTAATCATCTTTATGGTTATTTTATTTCTTTGGATTTAACTTATAGTTCTGTTGAAGTGATGTACAATTATTTTGATGGTAATGTCATTAAGCATGAATCTTATGATTTACCTGATGAAAAGGTTAGTAGTATATTAAGCATAATAAAAAAACATATTGATATTCAGGAGAAACTTGATACTTATAACGGACTATTAGGTGTGTCTGTTTCTATACATGGAGTTGTGGATAATGAGCAGCATGTGACATATTTACCATTCCATGAAACTGAAGGAATTTCAATTGCTAAGAAAATAAAAGAAATTACTAATGTTCCAGTCGTAGTTGAAAATGAAGCGAATCTTTCAGCGTTATATGAACGTAATTTTAATCATAATTTATCCTACAATAATCTTATTGCTTTAAGTATACATAAAGGTATTGGTGCTGGGCTTATTATTAATAATCAATTGTATCGTGGTGCAAATGGGGAAGCGGGTGAAATTGGAAAAACACTTGTCTCAAAAGTTAGCGATAATGTGGAGATCTTTCATAAGATTGAAGATATTTTTTCACAAGAAGCTTTACTGCATAATTTAAGTAATCAACTAAATGAGAAGATGACGCTTAGCAAATTAATTCAATTTTATAATGAAAAAAATCCAGTCGTAGTTGAAGAAATGGAACAATTTATAAATAAAATTGCTGTTTTAATACATAATTTAAACACCCAGTTTAATCCGAATGCAATTTACATTAACTGTCCATTGTTCAATGAAATGCCTGAAATATTAGAAGCAATTAAGAACCAGTTCAAACAATATTCACGTAACGAAATTCAAATAAAGTTAACATCTAATGTCAAATTTGCAACTTTGCTAGGTGGTACATTAGCAATTATCCAAAAAGTACTACAGATTAATGATATTTACTTAGATATAAAAGCATAA
hypothetical protein3766.7119542671.5-0.22234Unknown functionGeneralROK family protein (putative glucokinase)TIGR0074476.2Putative ROK-family transcriptional regulatorPF00480ROKROK familyCL0108Actin_ATPase117.5CytoplasmicIntracellularno predicted signal peptide015925748A0A0H3JS71NP_373281
MNDNEKRVLREIYNHHNISRTQISKNLEINKATISSILNKLKYKSLVNEVGEGDSTKSGGRKPILLKVNHLYGYFISLDLTYSSVEVMYNYFDGNVIKHESYDLPDEKVSSILSIIKKHIDIQEKLDTYNGLLGVSVSIHGVVDNEQHVTYLPFHETEGISIAKKIKEITNVPVVVENEANLSALYERNFNHNLSYNNLIALSIHKGIGAGLIINNQLYRGANGEAGEIGKTLVSKVSDNVEIFHKIEDIFSQEALLHNLSNQLNEKMTLSKLIQFYNEKNPVVVEEMEQFINKIAVLIHNLNTQFNPNAIYINCPLFNEMPEILEAIKNQFKQYSRNEIQIKLTSNVKFATLLGGTLAIIQKVLQINDIYLDIKA
no data available no polycistronic organisation predicted
SA0042S. aureus N315SAUPAN000108000-CDSSA0042hypothetical proteinchromosome-5099651388393no1122816NP_373282102308
ATTGAATTAATTGGCGATAAATCTACCGTTCAACAAGCTATTCATGCTTTACAATTAATTGGTTTTGAAAATGTAAAAAGTTACCGTTTGCCACAAACAAATATCGTCACATCATCTATTCATAGTTCTGAAATGACTGGTGAAGAACATAATGTATTAGATGTTCGTAATGATGATGAATGGCGTAAAGGTCATTTAAAACAAGCAATTCATATTCCTCACGGTAAACTTTTAAATGAAGATATACCTTTCGATAAAAATGACCTAATTTATGTACATTGTCAATCAGGTGTTAGAAGTTCAATAGCGGTAGGAATATTAGAATATAAAGGATTTACGAATATTGTTAACGTTAGAGGTGGCTATCAACATTTACCAGCATTTTTAAAATAG
hypothetical protein1306.9661514673.6-0.333846phage shock operon rhodanese PspETIGR0298133Polysulfide binding proteinPF00581RhodaneseRhodanese-like domainCL0031Phosphatase54.3CytoplasmicIntracellularno predicted signal peptide015925749A0A0H3JK26NP_373282
MELIGDKSTVQQAIHALQLIGFENVKSYRLPQTNIVTSSIHSSEMTGEEHNVLDVRNDDEWRKGHLKQAIHIPHGKLLNEDIPFDKNDLIYVHCQSGVRSSIAVGILEYKGFTNIVNVRGGYQHLPAFLK
no data available MicrobesOnline: SA0042 < SA0043 < SA0044
SA0043SA_RS00360S. aureus N315SAUPAN000109000-CDSSA0043hypothetical proteinchromosome-5139252330939no1122817NP_373283102309
TTGTTTTTCAAACAATTTTATGAAGACAATTTTTCACAAGCATCTTATTTAATTGGATGTCAACGTACAGGAGAAGCAATGATTATTGACCCTATACGAGATTTAACAAAATATTTAAAAGTTGCAGATAAAGAAGGATTCACAATTACTAAAGCTGCAGAAACACATATTCATGCTGATTTTGCTTCAGGTATTAGAGATGTGGCAAATAAATTGAATGCAAGTATATACGTATCTGATGAAGGTAAAGATGAATTTAATTATAAAAATATGCCTAAACAAACACATTTCGTTAAGCATCAAGATATTATCTATTTAGGAAAGATTAAATTAGAAGTCTTACACACTCCAGGCCATCCCCCTGAGAGTATTAGTTTTTTACTTACTGACGAAGGTGGGGGTTCCAGTATACCAATGGGATTATTTAGCGGTGACTTCATCTTTGTTGGTGATGTAGGTAGACCAGATCTATTAGAAAAAGCTGTAAATGTTGAAGGTTCTACAAAAATCGGAGCAAAACAAATGTATCAGTCCATACAATTTGCTGCAACATTACCAGACTATATTCAAATTTGGCCAGGTCATGGTGCAGGGAGTCCTTGTGGTAAAGCGCTAGGTTCATTACCTACAACTACTTTGGGTTATGAGAAAATAAACAACTGGGCTTTTAATGTTAAAGATGAAACTTCATTTATCGAAACTTTAACACTCAATCAGCCAGCTCCACCACACCATTTTTCACAAATGAAAAAAATAAATCAATTTGGTATGCAAATGTACCAACCATATAATGTTTACCCTAGTTCAAGCAATACACAAACTGCTTTTGATCTTCGAAGTAAAGAAGCATTCCATGGTGGTCATATGCATGGAACTATCAATATTCCTTTTAATAAAACTTTTATAAATCAAATTGGTTGGTATTTAGATTATGACTAA
hypothetical protein3126.5101634957.3-0.363141Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341369.4Zn-dependent hydroxyacylglutathione hydrolasePF00753Lactamase_BMetallo-beta-lactamase superfamilyCL0381Metallo-HOrase36no significant predictionIntracellularno predicted signal peptide015925750A0A0H3JJ83NP_373283
MFFKQFYEDNFSQASYLIGCQRTGEAMIIDPIRDLTKYLKVADKEGFTITKAAETHIHADFASGIRDVANKLNASIYVSDEGKDEFNYKNMPKQTHFVKHQDIIYLGKIKLEVLHTPGHPPESISFLLTDEGGGSSIPMGLFSGDFIFVGDVGRPDLLEKAVNVEGSTKIGAKQMYQSIQFAATLPDYIQIWPGHGAGSPCGKALGSLPTTTLGYEKINNWAFNVKDETSFIETLTLNQPAPPHHFSQMKKINQFGMQMYQPYNVYPSSSNTQTAFDLRSKEAFHGGHMHGTINIPFNKTFINQIGWYLDYD
no data available MicrobesOnline: SA0042 < SA0043 < SA0044
SA0044SA_RS00365S. aureus N315SAUPAN000110000-CDSSA0044hypothetical proteinchromosome-52363534271065no1122818NP_373284102310
ATGGAACAATACAAAGAAGTACACATTAATTCATTAAACAAAGAAGAATTAGAAAAATTGGCAAAAATGGGTCAATTGATTGATGTTAGAACAAAAGAAGAATATGAATTAGGACACATTAACGGTTCAACTTTACACCCAGTAGAAGAGATTAAATCATTCAATAAGAATAGCAACAAAACGTATTATATACATTGTAAAAGCGGTAACCGAAGCACTAAAGCTTGCGATTATTTAGCCAAACAAGGTTATGATGTCGTGAATTTAAAGGGTGGATATAAAGATTATGAAGCAAAGAACTTCAATAGTGCTCCTTTAATAGAAAAAGATATTGAAATCAAAGAGAATCGTAAACAATTTGATTTTAGAGGTCTTCAGTGCCCTGGACCTATTGTTAATATCAGTAAAGAAATTAACAATATTTCAACGGGTGAGCAAATCGAGGTAACAGTTACAGATCCTGGTTTCAATAGTGATATTAAAAGTTGGGCGAAACAAACAGGGAATACCCTTGTAAATCTTACTGAAGAAGCAAATGTAATTAATGCAATTATTCAAAAAGAAAAGCCAAAAGAATTTGAAATCAATGACACTGCTACAGGTACAACAATTGTTTTATTTAGCGGTGAGTTAGATAAGGCAGTAGCAGCAATGATCATCGCAAATGGCGCTAAAGCAGCAGGTAAAGATGTAACTATTTTCTTTACTTTTTGGGGCCTCAACGCATTAAAAAAAGCGCAATCAACTCGCGTTAAAAAGAAAGGTATTTCCAAAATGTTTGACCTTATGTTACCTAAGGATCCAATACATATGCCATTATCAAAAATGAATATGTTTGGACTAGGTAATATTATGATGCGTTATGTAATGAACAAGAAAAATGTTGATTCTTTATACTCACTTATCGATCAAGCAATCGATCAAGATATAAAGTTAATTGCTTGTACCATGAGTATGGATGTTATGGGAATTTCAAAAGAAGAATTAAGAGATGAAGTCGATTATGGTGGCGTAGGTACTTATATTGGACATACTGAGCAAGCAAATCATAACTTATTTATCTAA
hypothetical protein3546.8803639758.3-0.418079phage shock operon rhodanese PspETIGR0298132.8Disulfide bond regulatorPF13686DrsE_2DsrE/DsrF/DrsH-like familyCL0394DsrEFH-like187.4CytoplasmicIntracellularno predicted signal peptide015925751A0A0H3JN38NP_373284
MEQYKEVHINSLNKEELEKLAKMGQLIDVRTKEEYELGHINGSTLHPVEEIKSFNKNSNKTYYIHCKSGNRSTKACDYLAKQGYDVVNLKGGYKDYEAKNFNSAPLIEKDIEIKENRKQFDFRGLQCPGPIVNISKEINNISTGEQIEVTVTDPGFNSDIKSWAKQTGNTLVNLTEEANVINAIIQKEKPKEFEINDTATGTTIVLFSGELDKAVAAMIIANGAKAAGKDVTIFFTFWGLNALKKAQSTRVKKKGISKMFDLMLPKDPIHMPLSKMNMFGLGNIMMRYVMNKKNVDSLYSLIDQAIDQDIKLIACTMSMDVMGISKEELRDEVDYGGVGTYIGHTEQANHNLFI
no data available MicrobesOnline: SA0042 < SA0043 < SA0044
SA0045SA_RS00370S. aureus N315SAUPAN000111000-CDSSA0045hypothetical proteinchromosome+5356353823261no1122819NP_373285102311
ATGACTTATGATAAAAAAATGATTAATCGTATAAATAGAATACAAGGTCAATTAAATGGTGTCGTAAAAATGATGGAAGAAGAAAAAGATTGCAAAGATATAATTACGCAACTTAGTGCATCTAAAGGTTCTATACAACGTTTAATGGGGATTATAATTAGTGAAAATTTAATAGAATGCGTTAAAACAGCAGAAGAAAATAATGAAAGTTCTCAAGAATTAATTAATGAAGCAGTTAATTTATTAGTTAAAAGTAAATAA
hypothetical protein865.151919742.27-0.386046Metal-sensitive transcriptional repressorPF02583Trns_repr_metalMetal-sensitive transcriptional repressorno clan definedno clan defined83.9no significant predictionIntracellularno predicted signal peptide015925752A0A0H3JKR5NP_373285
MTYDKKMINRINRIQGQLNGVVKMMEEEKDCKDIITQLSASKGSIQRLMGIIISENLIECVKTAEENNESSQELINEAVNLLVKSK
no data available MicrobesOnline: SA0045 > SA0046
SA0046SA_RS00375S. aureus N315SAUPAN000112000-CDSSA0046hypothetical proteinchromosome+5382354467645no1122820NP_373286102312
ATGGATATAGCAAATATGACTATTATGTTGCTAATTGGCGTACTGGGTGGATTTATATCTGGATTAATAGGTATTGGGGGCGCAATTATTATTTACCCAGCTATTCTTATATTGCCACCATTAATAGGTATACCTGCGTATAGTGCATATATTGCTTCGGGACTTACCTCTAGTCAAGTATTTTTCAGTACACTTAGTGGATCATTAAATGCAAGAAAACAACCAGCTTTCTCTCCTAAACTTGTTATATATATGGGAGGGGGTATGTTGATTGGAAGCATGTTAGGGGCAATTTTAGCTAGTTTGTTTAATGCTACTTTTGTAAATACGGTATATGTAATAATCGCCATACTTGCTTTAATATTGATGTTTATTAAAGTTAAACCTACTACACAAGAGACGAAATCTAAACCTTTGCTATTTATTATAGTTGGATTTGGAATTGGTGTAATTTCGGGAATTGTGGGTGCAGGTGGAGCATTTATCATCATTCCTGTATTATTAGCATTATTTAAATTACCAATGAATACGGTAGTGAACAATAGCATAGCAATTGCTTTTATATCTTCAGTAGGGGCATTTTTTATAAAATTAATGCAAGGATATATACCAGTAGAAAGTGCAATTTTTTTGATAATTGAATGA
hypothetical protein21410.049222359.11.33084FIG003846: hypothetical proteinPF01925TauESulfite exporter TauE/SafECL0292LysE110.6Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide615925753A0A0H3JS77NP_373286
MDIANMTIMLLIGVLGGFISGLIGIGGAIIIYPAILILPPLIGIPAYSAYIASGLTSSQVFFSTLSGSLNARKQPAFSPKLVIYMGGGMLIGSMLGAILASLFNATFVNTVYVIIAILALILMFIKVKPTTQETKSKPLLFIIVGFGIGVISGIVGAGGAFIIIPVLLALFKLPMNTVVNNSIAIAFISSVGAFFIKLMQGYIPVESAIFLIIE
no data available MicrobesOnline: SA0045 > SA0046
SA0047SA_RS00380S. aureus N315SAUPAN000064000-CDSSA0047hypothetical proteinchromosome-5480655474669no1122821NP_373287102313
ATCTTTTTGAATACAATAGAATCACAGTTTGATAAGGTTGCAGAAGATTACGATTTCGTGAATGAGCTTTTGAATGATTATTCATTCTTTGTGTCTAATATGTCTCCAAAGAAAGGCAGAGCATTAGATATCGGATGTGGCTCGGGTTTGTTAGTGGAGAAATTAGCAAGTTATTATGATGAAGTGGTAGGGATTGATATTTCTAATCAAATGCTCGATCTTGCCAAATCTAAACGTCAACTAACAAATACGGTCTATCTGAATATGAATGCAGAACAACTTAATTTTAATGAGAAGTTTGATTTTATTGTAAGCCGAACAACCTTTCATCATTTGGATGATATAGCCAGCGTAATACAGCAAATGAAGGAACTGTTGAATGAGGAAGGAAGAATAGTTATTCTTGATAATGTATCTGAAGTCGAGACACCGCCTACCTATGTTTATAAATTAGGGGCAATCCAAGAGTTTTTACCGCATTGTTTCAAATTTGGAATAAAAAATGCGATTAGAATTTATAATCACAACACATCTAAATCATGGCTTGAGCATTTAGCTTCAGATAAGTACCTATCTGAACAAAATTATTACGATTTATATGAAAAGTTGTTGCCTGGATGCCAATTCCATAAAATGGGTTGGGCAATGGGGGTTGTCTGGACAAAATAA
hypothetical protein2224.9504225700.1-0.25991MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotinmalonyl-acyl carrier protein O-methyltransferase BioCTIGR0207267.7Mobile element proteinPF08241Methyltransf_11Methyltransferase domainCL0063NADP_Rossmann78.1Cytoplasmic MembraneIntracellularno predicted signal peptide015925754A0A0H3JK31NP_373287
MFLNTIESQFDKVAEDYDFVNELLNDYSFFVSNMSPKKGRALDIGCGSGLLVEKLASYYDEVVGIDISNQMLDLAKSKRQLTNTVYLNMNAEQLNFNEKFDFIVSRTTFHHLDDIASVIQQMKELLNEEGRIVILDNVSEVETPPTYVYKLGAIQEFLPHCFKFGIKNAIRIYNHNTSKSWLEHLASDKYLSEQNYYDLYEKLLPGCQFHKMGWAMGVVWTK
no data available
locus tagold locus tagnew locus tagorganismpan locus tagpan gene symboltypesymbolsynonymproductcommentrepliconstrandstartendgene lengthessentialGene IDgene RefSeqMicrobesOnlineDNAdescriptionprotein lengththeoretical pItheoretical MWGRAVYECTIGRFAM Meta RoleTIGRFAM Main RoleTIGRFAM Sub RoleTIGRFAM functionTIGRFAMTIGRFAM HMM scoreTheSEEDPFAM AccessionPFAMPFAM descriptionPFAM clan accessionPFAM clanPFAM HMM scoreeffectorinteraction partnersPSORTbLocatePSignalPtransmembrane helicesprotein GIUniProtprotein RefSeqprotein sequenceprotein peptides detectedprotein copies per celloperonregulatorpubmed
SA_RS00145SA0001S. aureus N315SAUPAN000006000dnaACDSSA_RS00145chromosomal replication initiator protein DnaAchromosome+51718781362unknownWP_001290433
ATGTCGGAAAAAGAAATTTGGGAAAAAGTGCTTGAAATTGCTCAAGAAAAATTATCAGCTGTAAGTTACTCAACTTTCCTAAAAGATACTGAGCTTTACACGATTAAAGATGGTGAAGCTATCGTATTATCGAGTATTCCTTTTAATGCAAATTGGTTAAATCAACAATATGCTGAAATTATCCAAGCAATCTTATTTGATGTTGTAGGCTATGAAGTTAAACCTCACTTTATTACTACTGAAGAATTAGCAAATTATAGTAATAATGAAACTGCTACTCCAAAAGAAACAACAAAACCTTCTACTGAAACAACTGAGGATAATCATGTGCTTGGTAGAGAGCAATTCAATGCCCATAACACATTTGACACTTTTGTAATCGGACCTGGTAACCGCTTTCCACATGCAGCAAGTTTAGCTGTAGCCGAAGCACCAGCCAAAGCGTACAATCCATTATTTATCTATGGAGGGGTTGGTTTAGGAAAAACCCATTTAATGCATGCCATTGGTCATCATGTTTTAGATAATAATCCAGATGCCAAAGTGATTTACACATCAAGTGAAAAATTCACAAATGAATTTATTAAATCAATTCGTGATAACGAAGGTGAAGCTTTCAGAGAAAGATATCGTAATATCGACGTCTTATTAATCGATGATATTCAGTTCATACAAAATAAAGTACAAACACAAGAAGAATTTTTCTATACTTTTAATGAATTGCATCAGAATAACAAGCAAATAGTTATTTCGAGTGATCGACCACCAAAGGAAATTGCACAATTAGAAGACCGATTACGTTCACGCTTTGAATGGGGGCTAATTGTTGATATTACGCCACCAGATTATGAAACTCGAATGGCAATTTTGCAGAAGAAAATTGAAGAAGAAAAATTAGATATTCCACCAGAAGCTTTAAATTATATAGCAAATCAAATTCAATCTAATATTCGTGAATTAGAAGGTGCATTAACACGTTTACTTGCATATTCACAATTATTAGGAAAACCAATTACAACTGAATTAACTGCTGAAGCTTTAAAAGATATCATTCAAGCACCAAAATCTAAAAAGATTACCATCCAAGATATTCAAAAAATTGTAGGCCAGTACTATAATGTTAGGATTGAAGATTTCAGTGCAAAAAAACGTACAAAGTCAATTGCATATCCGCGTCAAATAGCTATGTACTTGTCTAGAGAGCTTACAGATTTCTCATTACCTAAAATTGGTGAAGAATTTGGTGGGCGTGATCATACGACCGTCATTCATGCTCATGAAAAAATATCTAAAGATTTAAAAGAAGATCCTATTTTTAAACAAGAAGTAGAGAATCTTGAAAAAGAAATAAGAAATGTATAA
chromosomal replication initiator protein DnaA4535.1162651965.3-0.488742Genetic information processingDNA metabolismDNA replication, recombination, and repairchromosomal replication initiator protein DnaATIGR00362594.7PF00308Bac_DnaABacterial dnaA proteinCL0023P-loop_NTPase340.4Cytoplasmicno predicted signal peptide0447213177WP_001290433
MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
no data available
SA_RS00150SA0002S. aureus N315SAUPAN000007000dnaNCDSSA_RS00150DNA polymerase III subunit betachromosome+215632891134unknownWP_000969811
ATGATGGAATTCACTATTAAAAGAGATTATTTTATTACACAATTAAATGACACATTAAAAGCTATTTCACCAAGAACAACATTACCTATATTAACTGGTATCAAAATCGATGCGAAAGAACATGAAGTTATACTAACTGGTTCAGACTCTGAAATTTCAATAGAAATCACTATTCCTAAAACTGTAGATGGCGAAGATATTGTCAATATTTCAGAAACAGGCTCAGTAGTACTTCCTGGACGATTCTTTGTTGATATTATAAAAAAATTACCTGGTAAAGATGTTAAATTATCTACAAATGAACAATTCCAGACATTAATTACATCAGGTCATTCTGAATTTAATTTAAGTGGCTTAGATCCAGATCAATATCCTTTATTACCTCAAGTTTCTAGAGATGACGCAATTCAATTGTCGGTAAAAGTGCTTAAAAACGTGATTGCACAAACGAATTTTGCAGTGTCCACCTCAGAAACACGCCCAGTACTAACTGGTGTGAACTGGCTTATACAAGAAAATGAATTAATATGCACAGCGACTGACTCACACCGCTTGGCTGTAAGAAAGTTGCAGTTAGAAGATGTTTCTGAAAACAAAAATGTCATCATTCCAGGTAAGGCTTTAGCTGAATTAAATAAAATTATGTCTGACAATGAAGAAGACATTGATATCTTCTTTGCTTCAAACCAAGTTTTATTTAAAGTTGGAAATGTGAACTTTATTTCTCGATTATTAGAAGGACATTATCCTGATACAACACGTTTATTCCCTGAAAACTATGAAATTAAATTAAGTATAGACAATGGGGAGTTTTATCATGCGATTGATCGTGCCTCTTTATTAGCACGTGAAGGTGGTAATAACGTTATTAAATTAAGTACAGGTGATGACGTTGTTGAATTATCTTCTACATCACCAGAAATTGGTACTGTAAAAGAAGAAGTTGATGCAAACGATGTTGAAGGTGGTAGCCTGAAAATTTCATTCAACTCTAAATATATGATGGATGCTTTAAAAGCAATCGATAATGATGAGGTTGAAGTTGAATTCTTCGGTACAATGAAACCATTTATTCTAAAACCAAAAGGTGACGACTCGGTAACGCAATTAATTTTACCAATCAGAACTTACTAA
DNA polymerase III subunit beta3774.4028441913.3-0.1615382.7.7.7Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, beta subunitTIGR00663375.1PF00712DNA_pol3_betaDNA polymerase III beta subunit, N-terminal domainCL0060DNA_clamp184Cytoplasmicno predicted signal peptide0446892555WP_000969811
MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIRTY
no data available
SA_RS00155SA0003S. aureus N315SAUPAN000009000-CDSSA_RS00155RNA-binding proteinchromosome+36703915246unknownWP_001789359
GTGATTATTTTGGTTCAAGAAGTTGTAGTAGAAGGAGACATTAATTTAGGTCAATTTCTAAAAACAGAAGGGATTATTGAATCTGGTGGTCAAGCAAAATGGTTCTTGCAAGACGTTGAAGTATTAATTAATGGAGTGCGTGAAACACGTCGCGGTAAAAAGTTAGAACATCAAGATCGTATAGATATCCCAGAATTACCTGAAGATGCTGGTTCTTTCTTAATCATTCATCAAGGTGAACAATGA
RNA-binding protein814.355789137.35-0.197531Genetic information processingDNA metabolismDNA replication, recombination, and repairS4 domain protein YaaATIGR0298890PF13275S4_2S4 domainCL0492S474.4
SA_RS00690; SA_RS00835; SA_RS01275; SA_RS01445; SA_RS01960; SA_RS02095; SA_RS02490; SA_RS02735; SA_RS02840; SA_RS02860; SA_RS02900; SA_RS02905; SA_RS02915; SA_RS02930; SA_RS02945; SA_RS02955; SA_RS02960; SA_RS03155; SA_RS03250; SA_RS03475; SA_RS03545; SA_RS03645; SA_RS03665; SA_RS03915; SA_RS04140; SA_RS04145; SA_RS04150; SA_RS04155; SA_RS04160; SA_RS04325; SA_RS04660; SA_RS04680; SA_RS04865; SA_RS04935; SA_RS05190; SA_RS05295; SA_RS05330; SA_RS05620; SA_RS05895; SA_RS06085; SA_RS06165; SA_RS06235; SA_RS06490; SA_RS06645; SA_RS06855; SA_RS07005; SA_RS07385; SA_RS07400; SA_RS07605; SA_RS07695; SA_RS07725; SA_RS07820; SA_RS07880; SA_RS07955; SA_RS08210; SA_RS08545; SA_RS08550; SA_RS08630; SA_RS08640; SA_RS08760; SA_RS08865; SA_RS09005; SA_RS09060; SA_RS09775; SA_RS09850; SA_RS10535; SA_RS10855; SA_RS10940; SA_RS11010; SA_RS11075; SA_RS11130; SA_RS11145; SA_RS11150; SA_RS11245; SA_RS11430; SA_RS11600; SA_RS11635; SA_RS11660; SA_RS11695; SA_RS11760; SA_RS11770; SA_RS12060; SA_RS12645; SA_RS13255; SA_RS13375; SA_R
Cytoplasmicno predicted signal peptide0WP_001789359
MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ
no data available 21166474
SA_RS00160SA0004S. aureus N315SAUPAN000010000recFCDSSA_RS00160DNA replication and repair protein RecFchromosome+391250241113unknownWP_000775113
ATGAAGTTAAATACACTCCAATTAGAAAATTATCGTAACTATGATGAGGTTACGTTGAAATGTCATCCTGACGTGAATATCCTCATTGGAGAAAATGCACAAGGAAAGACAAATTTACTTGAATCAATTTATACCTTAGCTTTAGCAAAAAGTCATAGAACGAGTAATGATAAGGAACTCATACGTTTTAATGCTGATTATGCTAAAATAGAAGGTGAGCTTAGTTATAGACACGGCACGATGCCATTAACAATGTTTATAACTAAAAAAGGTAAACAAGTCAAAGTGAATCACTTAGAGCAAAGTCGTCTAACTCAATATATTGGACACCTCAATGTGGTTCTATTTGCGCCAGAAGATTTGAATATTGTAAAAGGCTCTCCTCAAATAAGACGACGCTTTATAGATATGGAGTTGGGCCAAATTTCTGCTGTTTACTTAAATGATTTAGCTCAATACCAACGTATTTTAAAGCAAAAGAATAATTACTTAAAGCAGTTACAATTAGGCCAAAAAAAGGACTTAACAATGTTGGAAGTATTAAATCAGCAGTTTGCTGAATATGCAATGAAAGTAACTGATAAACGTGCACATTTTATTCAAGAGCTAGAGTCGTTAGCTAAACCGATTCATGCTGGTATCACAAATGATAAAGAAGCGTTGTCGCTAAATTATTTACCTAGTCTTAAATTTGATTATGCTCAAAATGAAGCGGCACGACTTGAAGAAATTATGTCTATTCTTAGCGATAATATGCAAAGAGAAAAAGAACGAGGCATTAGCTTATTCGGACCACATCGAGATGATATAAGTTTTGATGTGAATGGCATGGATGCTCAAACATATGGTTCTCAAGGACAGCAACGTACAACGGCTTTGTCCATTAAATTAGCTGAAATTGAGTTAATGAATATCGAAGTTGGGGAATATCCCATCTTATTATTAGACGATGTACTCAGTGAATTAGATGATTCGCGTCAAACGCATTTATTAAGTACGATTCAGCATAAAGTACAAACATTTGTCACTACGACATCTGTAGATGGTATTGATCATGAAATCATGAATAACGCTAAATTGTATCGTATTAATCAAGGTGAAATTATAAAGTAA
DNA replication and repair protein RecF3706.4468842415.1-0.444054Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA replication and repair protein RecFTIGR00611474.6PF02463SMC_NRecF/RecN/SMC N terminal domainCL0023P-loop_NTPase60.4
SA_RS01275; SA_RS01365; SA_RS02905; SA_RS02910; SA_RS02915; SA_RS02920; SA_RS02955; SA_RS02960; SA_RS04160; SA_RS04575; SA_RS05325; SA_RS05350; SA_RS05355; SA_RS05365; SA_RS05860; SA_RS06140; SA_RS06225; SA_RS06295; SA_RS07060; SA_RS07065; SA_RS07205; SA_RS08295; SA_RS08470; SA_RS08505; SA_RS08545; SA_RS08560; SA_RS08625; SA_RS08675; SA_RS08760; SA_RS09855; SA_RS10845; SA_RS11430; SA_RS11630; SA_RS11640; SA_RS11670; SA_RS11680; SA_RS11690; SA_RS11695; SA_RS11705; SA_RS11720; SA_RS11735; SA_RS11740; SA_RS11750; SA_RS11755; SA_RS11760; SA_RS11765; SA_RS13375; SA_RS13735
Cytoplasmicno predicted signal peptide0446697767WP_000775113
MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKLYRINQGEIIK
no data available 21166474
SA_RS00165SA0005S. aureus N315SAUPAN000011000gyrBCDSSA_RS00165DNA gyrase subunit Bchromosome+503469681935unknownWP_000255578
ATGGTGACTGCATTGTCAGATGTAAACAACACGGATAATTATGGTGCTGGGCAAATACAAGTATTAGAAGGTTTAGAAGCAGTACGTAAAAGACCAGGTATGTATATAGGATCGACTTCAGAGAGAGGTTTGCACCATTTAGTGTGGGAAATTGTCGATAATAGTATCGATGAAGCATTAGCTGGTTATGCAAATAAAATTGAAGTTGTTATTGAAAAAGATAACTGGATTAAAGTAACGGATAACGGACGTGGTATCCCAGTTGATATTCAAGAAAAAATGGGACGTCCAGCTGTCGAAGTTATTTTAACTGTTTTACATGCTGGTGGTAAATTCGGCGGTGGCGGATACAAAGTATCTGGTGGTTTACATGGTGTTGGTTCATCAGTTGTAAACGCATTGTCACAAGACTTAGAAGTATATGTACACAGAAATGAGACTATATATCATCAAGCATATAAAAAAGGTGTACCTCAATTTGACTTAAAAGAAGTTGGCACAACTGATAAGACAGGTACTGTCATTCGTTTTAAAGCAGATGGAGAAATCTTCACAGAGACAACTGTATACAACTATGAAACATTACAGCAGCGTATTAGAGAGCTTGCTTTCTTAAACAAAGGAATTCAAATCACATTAAGAGATGAACGTGATGAAGAAAACGTTAGAGAAGACTCCTATCACTATGAGGGCGGTATTAAATCGTACGTTGAGTTATTGAACGAAAATAAAGAACCTATTCATGATGAGCCAATTTATATTCATCAATCTAAAGATGATATTGAAGTAGAAATTGCGATTCAATATAACTCAGGATATGCCACAAATCTTTTAACTTACGCAAATAACATTCATACGTATGAAGGTGGTACGCATGAAGACGGATTCAAACGTGCATTAACGCGTGTCTTAAATAGTTATGGTTTAAGTAGCAAGATTATGAAAGAAGAAAAAGATAGACTTTCTGGTGAAGATACACGTGAAGGTATGACAGCAATTATATCTATCAAACATGGTGATCCTCAATTCGAAGGTCAAACGAAGACAAAATTAGGTAATTCTGAAGTGCGTCAAGTTGTAGATAAATTATTCTCAGAGCACTTTGAACGATTTTTATATGAAAATCCACAAGTCGCACGTACAGTGGTTGAAAAAGGTATTATGGCGGCACGTGCACGTGTTGCTGCGAAAAAAGCGCGTGAAGTAACACGTCGTAAATCAGCGTTAGATGTAGCAAGTCTTCCAGGTAAATTAGCCGATTGCTCTAGTAAAAGTCCTGAAGAATGTGAGATTTTCTTAGTCGAAGGGGACTCTGCCGGGGGGTCTACAAAATCTGGTCGTGACTCTAGAACGCAGGCGATTTTACCATTACGAGGTAAGATATTAAATGTTGAAAAAGCACGATTAGATAGAATTTTGAATAACAATGAAATTCGTCAAATGATCACAGCATTTGGTACAGGAATCGGTGGCGACTTTGATCTAGCGAAAGCAAGATATCACAAAATCGTCATTATGACTGATGCCGATGTGGATGGAGCGCATATTAGAACATTGTTATTAACATTCTTCTATCGATTTATGAGACCGTTAATTGAAGCAGGCTATGTGTATATTGCACAGCCACCGTTGTATAAACTGACACAAGGTAAACAAAAGTATTATGTATACAATGATAGGGAACTTGATAAACTTAAATCTGAATTGAATCCAACACCAAAATGGTCTATTGCACGATACAAAGGTCTTGGAGAAATGAATGCAGATCAATTATGGGAAACAACAATGAACCCTGAGCACCGCGCTCTTTTACAAGTAAAACTTGAAGATGCGATTGAAGCGGACCAAACATTTGAAATGTTAATGGGTGACGTTGTAGAAAACCGTAGACAATTTATAGAAGATAATGCAGTTTATGCAAACTTAGACTTCTAA
DNA gyrase subunit B6445.7942772539.4-0.4905285.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, B subunitTIGR01059993.9PF00204DNA_gyraseBDNA gyrase BCL0329S5211.7
SA_RS00170; SA_RS02955; SA_RS06295; SA_RS08560
Cytoplasmicno predicted signal peptide0446177723WP_000255578
MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANKIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
no data available 21166474
SA_RS00170SA0006S. aureus N315SAUPAN000012000gyrACDSSA_RS00170DNA gyrase subunit Achromosome+700596742670unknownWP_000819096
ATGGCTGAATTACCTCAATCAAGAATAAATGAACGAAATATTACCAGTGAAATGCGTGAATCATTTTTAGATTATGCGATGAGTGTTATCGTTGCTCGTGCATTGCCAGATGTTCGTGACGGTTTAAAACCAGTACATCGTCGTATACTATATGGATTAAATGAACAAGGTATGACACCGGATAAATCATATAAAAAATCAGCACGTATCGTTGGTGACGTAATGGGTAAATATCACCCTCATGGTGACTCATCTATTTATGAAGCAATGGTACGTATGGCTCAAGATTTCAGTTATCGTTATCCGCTTGTTGATGGCCAAGGTAACTTTGGTTCAATGGATGGAGATGGCGCAGCAGCAATGCGTTATACTGAAGCGCGTATGACTAAAATCACACTTGAACTGTTACGTGATATTAATAAAGATACAATAGATTTTATCGATAACTATGATGGTAATGAAAGAGAGCCGTCAGTCTTACCTGCTCGATTCCCTAACTTGTTAGCCAATGGAGCATCAGGTATAGCGGTAGGTATGGCAACGAATATTCCACCACATAACTTAACAGAATTAATCAATGGTGTACTTAGCTTAAGTAAGAACCCTGATATTTCAATTGCTGAGTTAATGGAGGATATTGAAGGTCCTGATTTCCCAACTGCTGGACTTATTTTAGGTAAGAGTGGTATTAGACGTGCATATGAAACAGGTCGTGGTTCAATTCAAATGCGTTCTCGTGCAGTTATTGAAGAACGTGGAGGCGGACGTCAACGTATTGTTGTCACTGAAATTCCTTTCCAAGTGAATAAGGCTCGTATGATTGAAAAAATTGCAGAGCTCGTTCGTGACAAGAAAATTGACGGTATCACTGATTTACGTGATGAAACAAGTTTACGTACTGGTGTGCGTGTCGTTATTGATGTGCGTAAGGATGCAAATGCTAGTGTCATTTTAAATAACTTATACAAACAAACACCTCTTCAAACATCATTTGGTGTGAATATGATTGCACTTGTAAATGGTAGACCGAAGCTTATTAATTTAAAAGAAGCGTTGGTACATTATTTAGAGCATCAAAAGACAGTTGTTAGAAGACGTACGCAATACAACTTACGTAAAGCTAAAGATCGTGCCCACATTTTAGAAGGATTACGTATCGCACTTGACCATATCGATGAAATTATTTCAACGATTCGTGAGTCAGATACAGATAAAGTTGCAATGGAAAGCTTGCAACAACGCTTCAAACTTTCTGAAAAACAAGCTCAAGCTATTTTAGACATGCGTTTAAGACGTCTAACAGGTTTAGAGAGAGACAAAATTGAAGCTGAATATAATGAGTTATTAAATTATATTAGTGAATTAGAAACAATCTTAGCTGATGAAGAAGTATTACTACAATTAGTTAGAGATGAATTAACAGAAATTCGAGATCGTTTCGGTGATGATCGTCGTACTGAAATCCAATTAGGTGGATTTGAAGATTTAGAAGATGAAGATCTCATTCCAGAAGAACAAATTGTAATTACACTAAGCCATAATAACTACATTAAACGTTTGCCGGTATCTACATATCGTGCTCAAAACCGTGGTGGTCGTGGTGTTCAAGGTATGAATACATTGGAAGAAGATTTTGTCAGTCAATTGGTAACTTTAAGTACACATGACCATGTATTGTTCTTTACTAACAAAGGTCGTGTATACAAACTTAAAGGTTATGAAGTGCCTGAGTTATCAAGACAGTCTAAAGGTATTCCTGTAGTGAATGCTATTGAACTTGAAAATGATGAAGTCATTAGTACAATGATTGCTGTTAAAGACCTTGAAAGTGAAGACAACTTCTTAGTGTTTGCAACTAAACGTGGTGTCGTTAAACGTTCAGCATTAAGTAACTTCTCAAGAATAAATAGAAATGGTAAGATTGCGATTTCGTTCAGAGAAGATGATGAGTTAATTGCAGTTCGCTTAACAAGTGGTCAAGAAGATATCTTGATTGGTACATCACATGCATCATTAATTCGATTCCCTGAATCAACATTACGTCCTTTAGGCCGTACAGCAACGGGTGTGAAAGGTATTACACTTCGTGAAGGTGACGAAGTTGTAGGGCTTGATGTAGCTCATGCAAACAGTGTTGATGAAGTATTAGTAGTTACTGAAAATGGTTATGGTAAACGTACGCCAGTTAATGACTATCGTTTATCAAATCGTGGTGGTAAAGGTATTAAAACAGCTACGATTACTGAGCGTAATGGTAATGTTGTATGTATCACTACAGTAACTGGTGAAGAAGATTTAATGATTGTTACTAATGCAGGTGTCATTATTCGACTAGATGTTGCAGATATTTCTCAAAATGGTCGTGCAGCACAAGGTGTTCGCTTAATTCGCTTAGGTGATGATCAATTTGTTTCAACGGTTGCTAAAGTAAAAGAAGATGCAGAAGATGAAACGAATGAAGATGAGCAATCTACTTCAACTGTATCTGAAGATGGTACTGAACAACAACGTGAAGCGGTTGTAAATGATGAAACACCAGGAAATGCAATTCATACTGAAGTGATTGATTCAGAAGAAAATGATGAAGATGGACGTATTGAAGTAAGACAAGATTTCATGGATCGTGTTGAAGAAGATATACAACAATCATCAGATGAAGATGAAGAATAA
DNA gyrase subunit A8894.7402699624.5-0.458835.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, A subunitTIGR010631211.4PF00521DNA_topoisoIVDNA gyrase/topoisomerase IV, subunit Ano clan definedno clan defined529.7
SA_RS07060
Cytoplasmicno predicted signal peptide0446741840WP_000819096
MAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLGGFEDLEDEDLIPEEQIVITLSHNNYIKRLPVSTYRAQNRGGRGVQGMNTLEEDFVSQLVTLSTHDHVLFFTNKGRVYKLKGYEVPELSRQSKGIPVVNAIELENDEVISTMIAVKDLESEDNFLVFATKRGVVKRSALSNFSRINRNGKIAISFREDDELIAVRLTSGQEDILIGTSHASLIRFPESTLRPLGRTATGVKGITLREGDEVVGLDVAHANSVDEVLVVTENGYGKRTPVNDYRLSNRGGKGIKTATITERNGNVVCITTVTGEEDLMIVTNAGVIIRLDVADISQNGRAAQGVRLIRLGDDQFVSTVAKVKEDAEDETNEDEQSTSTVSEDGTEQQREAVVNDETPGNAIHTEVIDSEENDEDGRIEVRQDFMDRVEEDIQQSSDEDEE
no data available 21166474
SA_RS00175SA0007S. aureus N315SAUPAN000013000nnrDCDSSA_RS00175NAD(P)H-hydrate dehydratasechromosome-976210574813unknownWP_000449218
ATGGAAACGTTAAATTCTATTAACATTCCTAAGCGTAAAGAAGATTCACATAAAGGTGATTATGGCAAAATTTTATTAATTGGTGGATCTGCTAACTTAGGTGGTGCCATTATGTTAGCGGCTCGTGCATGTGTATTTAGCGGTAGTGGTTTAATCACTGTAGCTACACATCCAACAAATCATTCAGCATTACATTCTCGTTGCCCAGAAGCGATGGTTATTGATATTAATGATACGAAAATGTTGACGAAAATGATTGAAATGACTGACAGTATACTAATTGGTCCAGGTCTTGGCGTTGATTTCAAAGGAAATAATGCCATTACATTCCTACTACAAAATATACAACCGCATCAAAATTTAATCGTAGACGGCGATGCGATTACAATCTTTAGTAAACTGAAACCGCAATTACCTACATGTCGTGTGATCTTTACTCCACACCTCAAAGAATGGGAACGATTAAGTGGTATTCCTATTGAGGAACAGACATATGAGCGTAATCGTGAAGCAGTTGATCGTTTAGGTGCAACTGTTGTACTTAAAAAACATGGTACTGAAATTTTCTTTAAAGATGAAGACTTTAAATTAACAATCGGTAGCCCAGCAATGGCGACTGGTGGTATGGGCGATACACTTGCTGGTATGATTACAAGTTTTGTCGGTCAATTTGATAACTTAAAAGAAGCGGTTATGAGTGCCACATATACACATAGTTTTATTGGCGAAAACCTTGCAAAAGATATGTATGTGGTACCACCATCAAGACTTATCAATGAAATACCTTACGCAATGAAACAATTAGAAAGTTAA
NAD(P)H-hydrate dehydratase2706.512229549-0.05259264.2.1.136Unknown functionGeneralYjeF family C-terminal domainTIGR00196185.2PF01256Carb_kinaseCarbohydrate kinaseCL0118Ribokinase194.5no significant predictionno predicted signal peptide1446371363WP_000449218
METLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIMLAARACVFSGSGLITVATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQNIQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDRLGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSATYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
no data available
SA_RS00180SA0008S. aureus N315SAUPAN000014000hutHCDSSA_RS00180histidine ammonia-lyasechromosome+10900124141515unknownWP_000177465
ATGACTTTATATTTAGATGGTGAAACACTAACAATTGAGGATATTAAATCATTTTTACAACAACAATCAAAGATTGAAATTATTGATGATGCGTTAGAACGTGTCAAAAAAAGTAGAGCGGTAGTTGAACGTATTATTGAAAATGAGGAAACGGTTTACGGTATCACTACAGGTTTTGGGTTATTTAGTGATGTACGTATAGACCCGACGCAATATAATGAATTACAAGTGAATCTGATACGCTCACATGCCTGTGGACTAGGTGAGCCATTTTCAAAAGAAGTAGCATTAGTCATGATGATTTTACGATTGAATACATTATTAAAAGGTCATTCAGGTGCCACTTTAGAATTAGTGAGACAATTACAATTTTTTATAAATGAACGTATTATACCGATAATCCCACAACAAGGCTCTCTCGGTGCATCAGGAGATTTAGCGCCATTATCACATTTAGCATTAGCATTAATTGGTGAAGGGAAAGTATTGTACAGAGGGGAAGAAAAGGATAGTGACGATGTATTAAGAGAATTAAATAGACAACCTTTGAACCTTCAGGCTAAAGAGGGTTTAGCATTGATTAATGGTACGCAAGCTATGACAGCTCAAGGTGTCATTAGTTATATAGAAGCAGAAGATTTAGGTTACCAATCTGAATGGATTGCTGCATTAACGCATCAGTCTCTTAATGGCATTATAGATGCATATCGACATGATGTGCACTCTGTTCGTAATTTTCAAGAACAGATTAATGTGGCAGCGCGTATGCGTGATTGGTTAGAAGGATCAACATTAACGACGCGACAAGCAGAAATACGTGTACAAGATGCATATACGTTGCGTTGTATACCACAAATCCATGGCGCGAGTTTTCAAGTATTCAATTATGTTAAACAGCAATTAGAATTTGAAATGAATGCGGCTAATGATAATCCACTTATATTTGAGGAAGCAAATGAAACGTTTGTTATTTCAGGTGGTAACTTCCATGGACAACCTATTGCTTTTGCATTAGATCATCTTAAATTAGGTGTAAGTGAATTAGCAAACGTATCGGAACGTCGTCTAGAGCGACTAGTAAATCCTCAATTAAATGGTGATTTACCAGCATTTCTTAGTCCAGAGCCAGGATTGCAAAGTGGCGCGATGATTATGCAATATGCTGCTGCAAGTCTCGTTTCTGAAAATAAAACTTTAGCGCATCCAGCGAGTGTTGATTCTATCACTTCATCTGCGAACCAAGAAGATCACGTATCTATGGGAACTACAGCTGCTAGACATGGTTATCAAATTATTGAAAATGCAAGACGTGTGTTGGCAATCGAATGTGTTATTGCATTACAAGCAGCAGAGTTGAAAGGTGTCGAAGGATTATCACCAAAAACACGTCGTAAATATGAGGAGTTTCGAAGTATCGTGCCATCCATTACACATGACCGTCAATTTCATAAAGATATTGAAGCGGTTGCACAGTATTTAAAGCAATCAATTTATCAAACGACTGCATGTCACTAA
histidine ammonia-lyase5045.1492856089.2-0.1857144.3.1.3MetabolismEnergy metabolismAmino acids and amineshistidine ammonia-lyaseTIGR01225664.2PF00221Lyase_aromaticAromatic amino acid lyaseno clan definedno clan defined611.5Cytoplasmicno predicted signal peptide0446099610WP_000177465
MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERIIENEETVYGITTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRLNTLLKGHSGATLELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVLYRGEEKDSDDVLRELNRQPLNLQAKEGLALINGTQAMTAQGVISYIEAEDLGYQSEWIAALTHQSLNGIIDAYRHDVHSVRNFQEQINVAARMRDWLEGSTLTTRQAEIRVQDAYTLRCIPQIHGASFQVFNYVKQQLEFEMNAANDNPLIFEEANETFVISGGNFHGQPIAFALDHLKLGVSELANVSERRLERLVNPQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTLAHPASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKGVEGLSPKTRRKYEEFRSIVPSITHDRQFHKDIEAVAQYLKQSIYQTTACH
no data available
SA_RS14380S. aureus N315CDSSA_RS14380hypothetical proteinchromosome-1261512803189unknownWP_001803754
ATGTCTAACATTAACCTTCATCCTTTCCCAAATAATTATCATTTATTATGGAATGACGTACGTCTTTATTTTTTAGAAAATAAAAAAAGACCACATCCCTACAAGGGACGTGGTCTACGCGTTGCCACCCTATTTAACAATTTAAGTTATAAAGATACACTAAACCTAAATTGCACTTCACTAAAATAA
hypothetical protein6210.37987404.49-0.662903no significant predictionno predicted signal peptide0WP_001803754
MSNINLHPFPNNYHLLWNDVRLYFLENKKRPHPYKGRGLRVATLFNNLSYKDTLNLNCTSLK
no data available
SA_RS00185SA0009S. aureus N315SAUPAN000017000serSCDSSA_RS00185serine--tRNA ligasechromosome+12793140791287unknownWP_000884332
ATGTTAGACATTAGATTATTCAGAAATGAGCCTGACACAGTTAAGAGCAAAATTGAATTACGTGGAGATGATCCAAAAGTTGTAGATGAAATTTTAGAATTGGATGAGCAACGACGTAAATTAATTAGTGCAACAGAAGAAATGAAAGCACGTCGTAATAAAGTAAGCGAAGAAATCGCATTAAAAAAACGTAATAAAGAAAATGCTGATGATGTGATTGCTGAAATGCGCACATTAGGTGACGATATTAAAGAAAAAGATAGTCAATTAAATGAAATTGATAATAAAATGACAGGTATCCTTTGTCGTATTCCAAATTTAATAAGTGATGATGTACCTCAAGGTGAATCTGATGAAGATAACGTTGAAGTTAAAAAGTGGGGTACACCACGTGAGTTTTCATTTGAACCAAAAGCACATTGGGATATTGTAGAAGAATTGAAAATGGCTGATTTTGATCGTGCAGCAAAAGTTTCAGGTGCGCGTTTTGTATATTTAACAAATGAAGGTGCGCAATTAGAGCGTGCTTTAATGAACTATATGATTACAAAACATACAACACAACATGGTTATACAGAAATGATGGTACCACAGCTTGTGAACGCAGATACAATGTATGGTACAGGTCAATTACCTAAATTTGAAGAAGATTTATTTAAAGTAGAAAAAGAAGGATTATATACAATTCCAACTGCTGAAGTACCATTAACGAATTTCTACCGTAATGAAATTATTCAACCAGGTGTACTTCCTGAAAAATTCACTGGTCAATCTGCATGTTTCCGTAGTGAAGCAGGATCAGCAGGTAGAGATACAAGAGGATTAATTCGTTTACATCAATTCGATAAAGTGGAAATGGTACGTTTTGAACAACCTGAAGATTCATGGAATGCTTTAGAAGAAATGACAACAAATGCAGAAGCAATTCTAGAAGAGTTAGGTTTACCATACCGTCGTGTTATTTTATGTACAGGTGATATTGGATTTAGTGCAAGCAAAACATATGATATAGAAGTTTGGTTACCAAGCTACAATGATTATAAAGAAATTAGTTCATGCTCAAACTGTACGGATTTCCAAGCGCGTCGTGCTAACATCCGCTTCAAGCGTGACAAAGCAGCTAAACCAGAATTAGCACATACATTAAATGGTAGTGGTTTAGCAGTTGGACGTACATTTGCTGCTATTGTTGAAAATTACCAAAATGAAGATGGAACAGTAACAATTCCAGAAGCATTAGTACCATTTATGGGTGGTAAAACACAAATTTCAAAACCAGTTAAATAA
serine--tRNA ligase4284.7466548639.7-0.5850476.1.1.11Genetic information processingProtein synthesistRNA aminoacylationserine--tRNA ligaseTIGR00414571.6PF00587tRNA-synt_2btRNA synthetase class II core domain (G, H, P, S and T)CL0040tRNA_synt_II115.4
SA_RS02955; SA_RS02960; SA_RS04140; SA_RS05350; SA_RS05355; SA_RS05360; SA_RS05365; SA_RS06225; SA_RS07065; SA_RS07955; SA_RS08435; SA_RS08560; SA_RS08600; SA_RS11430; SA_RS11750; SA_RS13920
Cytoplasmicno predicted signal peptide0446807076WP_000884332
MLDIRLFRNEPDTVKSKIELRGDDPKVVDEILELDEQRRKLISATEEMKARRNKVSEEIALKKRNKENADDVIAEMRTLGDDIKEKDSQLNEIDNKMTGILCRIPNLISDDVPQGESDEDNVEVKKWGTPREFSFEPKAHWDIVEELKMADFDRAAKVSGARFVYLTNEGAQLERALMNYMITKHTTQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVEKEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRDTRGLIRLHQFDKVEMVRFEQPEDSWNALEEMTTNAEAILEELGLPYRRVILCTGDIGFSASKTYDIEVWLPSYNDYKEISSCSNCTDFQARRANIRFKRDKAAKPELAHTLNGSGLAVGRTFAAIVENYQNEDGTVTIPEALVPFMGGKTQISKPVK
no data available 21166474
SA_RS00190SA0010S. aureus N315SAUPAN000018000-CDSSA_RS00190branched-chain amino acid ABC transporter permeasechromosome+1473015425696unknownWP_000190726
ATGGCAACACATTTAAGTTTTAGACAAGGCGTACAAGAGTGTATCCCAACATTATTGGGTTATGCCGGTGTTGGTATTTCATTTGGTATTGTGGCTTCGTCTCAAAACTTTAGTATTTTAGAAATTATCTTGTTATGTCTTGTTATATATGCCGGTGCTGCGCAATTTATTATGTGCGCGTTGTTTATAGCAGGTACACCGATATCAGCGATTGTACTAACTGTATTTATCGTAAATTCAAGAATGTTCCTTTTAAGTATGTCGCTTGCACCAAACTTCAAGACATATGGGTTTTGGAACCGTGTTGGATTAGGTTCATTAGTAACTGACGAAACGTTTGGCGTCGCCATTACACCTTATTTAAAAGGAGAAGCTATCAATGATCGTTGGATGCATGGTCTTAATATCACAGCATATTTATTTTGGGCAATTTCATGTGTAGCTGGGGCTTTATTTGGCGAATATATCTCAAATCCGCAAACGCTAGGGTTAGATTTTGCTATCACGGCTATGTTTATCTTTTTGGCCATTGCGCAATTTGAATCAATTACTAAATCGCGATTAAGAATTTACATAGTACTCATTATTGCCGTCATAGTAATGATGTTATCGCTAAGTATGTTTATGCCTTCATATCTAGCAATATTAATTGCAGCCACAATTTCAGCAGCGTTAGGAGTGATGATGGAACGATGA
branched-chain amino acid ABC transporter permease2317.28388251591.05628MetabolismTransport and binding proteinsAmino acids, peptides and aminesazaleucine resistance protein AzlCTIGR0034690.1PF03591AzlCAzlC proteinno clan definedno clan defined129Cytoplasmic Membraneno predicted signal peptide7446112871WP_000190726
MATHLSFRQGVQECIPTLLGYAGVGISFGIVASSQNFSILEIILLCLVIYAGAAQFIMCALFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPYLKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQFESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMER
no data available
SA_RS00195SAS001S. aureus N315SAUPAN000019000-CDSSA_RS00195membrane proteinchromosome+1542215751330unknownWP_000628051
ATGATAACTCATATGAACATGTTAATACTTATTTTATTGTGTGGTATCGTAACGCTATTAATTCGAATTATACCTTTTATCATGATTTCAAAAGTGCAATTGCCTGATGTTGTGGTTCGATGGCTATCATTTATCCCAATCACACTATTTACGGCACTTGTCATTGACAGCATTATTCAACAGACGCCTCATGGTGAGGGGTATACATTAAACATCCCTTACATTATCGCGCTCATTCCGACGGTTATTTTATCTATAATCACGCGTAGTTTAACTATTACAATTATTAGTGGGATTGTTATCATGGCAACATTACGATTTTTCTTTTAA
membrane protein1099.2996112263.11.45229PF05437AzlDBranched-chain amino acid transport protein (AzlD)no clan definedno clan defined82.6Cytoplasmic Membraneno predicted signal peptide4446550705WP_000628051
MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQQTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMATLRFFF
no data available
SA_RS00200SA0011S. aureus N315SAUPAN000021000metXCDSSA_RS00200homoserine O-acetyltransferasechromosome+1611417082969unknownWP_000186490
ATGACAAATTACACAGTAGATACTTTAAATCTAGGGAAATTTATTACAGAATCTGGGGAAGTCATAGATAACTTGCGTTTGAGATATGAGCATGTTGGTTATCATGGACAACCATTAGTTGTAGTTTGTCATGCATTAACTGGCAATCATTTAACATATGGAACAGATGATTATCCGGGTTGGTGGCGAGAAATTATTGATGGGGGATATATACCCATTCACGATTATCAATTTTTAACATTTGATGTTATTGGTAGTCCTTTCGGTTCAAGTTCACCTTTAAACGACCCTCATTTTCCTAAAAAATTAACATTAAGAGATATAGTCAGAGCGAATGAACGAGGTATACAAGCCCTTGGTTATGATAAGATTAATATTTTAATAGGGGGAAGTCTTGGAGGTATGCAAGCAATGGAACTACTTTACAATCAACAGTTTGAAGTAGATAAAGCCATTATCCTTGCTGCAACAAGTCGAACATCATCTTATAGTAGAGCTTTCAATGAAATTGCAAGGCAAGCCATTCATCTTGGTGGTAAGGAAGGTCTAAGTATTGCACGCCAATTAGGTTTTTTGACATATCGATCATCAAAAAGTTATGATGAACGTTTCACGCCGGATGAAGTAGTCGCATACCAACAACATCAAGGTAATAAATTTAAAGAACATTTTGATTTGAATTGTTATCTGACACTGCTAGATGTATTGGATAGTCACAACATTGACCGAGGTCGCACAGACGTAACGCATATTTTTAAAAATTTAGAAACGAAAGTCTTAACGATGGGGTTCATAGATGATTTGCTATATCCGGACGATCAAGTTCGTGCATTAGGTGAACGTTTTAAATATCATCGTCATTTCTTCGTGCCTGATAATGTTGGACATGATGGATTCCTACTAAACTTTAGTACCTGGGCACCTAACTTATATCATTTCTTAAATTTAAAGCATTTTAAGCGTAAGTAA
homoserine O-acetyltransferase3226.8401936940.5-0.349379MetabolismAmino acid biosynthesisAspartate familyhomoserine O-acetyltransferaseTIGR01392200.9PF00561Abhydrolase_1alpha/beta hydrolase foldCL0028AB_hydrolase59.4Cytoplasmicno predicted signal peptide0446108635WP_000186490
MTNYTVDTLNLGKFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHIFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRK
no data available
SA_RS00205SA0012S. aureus N315SAUPAN000023000-CDSSA_RS00205membrane proteinchromosome+1737518313939unknownWP_001800884
ATGGGAGTGGCTTATGTGTTTTCAAAAATACAACCTAAAGCAACAATAATTGCAACGATTACGTTGGTATTTGTCGCTTTAGCTTTATATCTAGTGCCTGGTTTGGGACTAATATTTGCATTATTTGCAACCATACCAGGTATCGTTTTATGGAATAAATCAATACAATCTTTCGGGGTTAGTGCACTTATTACAGTAATTATAACAACTGTTTTAGGTAATACTTTCGTTTTAAGTGCCATCATATTAGTCTTAATTGCAAGTTTAATTATTGGTCAATTGCTCAAAGAAAGAACGTCTAAAGAAAGAATGTTATACGTAACAACAGTAGCGATGAGCTTAATTTCATTAATCGCTTTTATGTTACTACAAACATTCGGAAGGATTCCACCATCAGCGAGCATAGTAAAACCTTTCAAGCAAACATTACATGAAGCGATTACGATGAGCGGTGCCGATGCGAATATGACCCAAATATTAGAAGAAGGGTTTAGACAAGCGACCGTTCAATTACCAGGTTTCATCATTATCATTACATTTTTAATCGTCTTAATTAACTTAATCGTTACATTTCCGGTTTTACGAAAATTTAAAATCGCTACACCTGTATTTAAGCCACTTTTCGCGTGGCAAATGAGCGGTATTTTATTATGGATATACATTATTGTTATCATATGTTTATTATTTACAGGTCAACCGAGTGTGTTCCAGAGCATTCTTTTAAACTTCCAACTTGTGTTATCATTAGTAATGTATATTCAAGGTTTAAGTGTTATTCATTTCTTTGGTAAAGCGAAAGGTTTGCCGAATGCAGTAACGATTTTACTATTGATTATCGGTACAATACTGACACCTACGACACATATTGTAGGACTACTTGGTGTTATCGATTTAAGTTTGAATTTGAAGCGAATCATGAAAAATAATTCTAAAAAGTGA
membrane protein31210.865834182.61.12821PF09991DUF2232Predicted membrane protein (DUF2232)no clan definedno clan defined210.7Cytoplasmic Membraneno predicted signal peptide7487716652WP_001800884
MGVAYVFSKIQPKATIIATITLVFVALALYLVPGLGLIFALFATIPGIVLWNKSIQSFGVSALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSKERMLYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILEEGFRQATVQLPGFIIIITFLIVLINLIVTFPVLRKFKIATPVFKPLFAWQMSGILLWIYIIVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLIIGTILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
no data available
SA_RS00210SA0013S. aureus N315SAUPAN000024000-CDSSA_RS00210DHH family phosphoesterasechromosome+18328202951968unknownWP_001081640
ATGAATCGGCAGTCCACTAAGAAAGCTTTACTAATACCATTTGTCATCATGATCATCACAGCAATTGTTTTAATGGGTGTATGGTTTATCTTTAATAGTCTTATAGCATTAATTGCATCTATCGTTCTTGTCGTGATGATTATTGTTAGCATCATTTTATTCAGACAAGCTTTAATGAAAATGGATAGTTATGTAGATGGTTTGAGTGCTCAAATTTCAACAACAAATAATAAAGCAATCAAACATTTACCAATTGGTATCATTGTTTTAGATGAAAATGATCACATCGAATGGGTTAACCAATTTATGACAAATCATATGGAAGCAAATGTCATTTCTGAATCTGTAAATGAAGTATTTCCAAACATTTTAAAGCAATTAGATAGAGTGAAATCCGTTGAAATAGAATATAATCAGTATCATTTCCAAGTACGTTATTCTGAGAATGATCATTGCCTCTATTTCTTTGATATAACTGAACAAGTACAAACAAATGAACTATATGAAAATTCTAAACCAATCATTGCGACATTATTTTTAGATAACTACGATGAGATTACTCAAAATATGAATGATACGCAGCGTTCGGAAATCAATTCAATGGTAACGCGTGTTATTAGTCGATGGGCAACTGAGTATAATATATTCTTTAAAAGGTATAGTTCCGATCAATTCGTAGCCTATTTAAATCAAAAAATATTAGCTGACTTAGAAGAATCTAAATTTGATATCTTGAGTCAATTACGTGAAAAAAGTGTTGGTTATCGTGCCCAATTAACATTAAGTATTGGTGTTGGTGAAGGTACTGAAAATTTAATCGATTTAGGTGAATTATCACAATCAGGCCTAGACTTAGCATTAGGGCGCGGTGGCGACCAAGTTGCAATTAAAAGTATTAATGGTAATGTGCGTTTCTATGGCGGTAAGACTGACCCGATGGAGAAACGTACTCGTGTAAGAGCACGAGTGATCTCACATGCGTTAAAAGATATCCTTGCAGAGGGTGACAAAGTCATTATCATGGGACATAAACGTCCTGACTTAGATGCAATTGGTGCAGCAATCGGTGTGTCTAGATTTGCAATGATGAATAATTTAGAAGCATACATCGTATTAAATGAGACTGACATTGATCCAACATTACGACGCGTGATGAACGAAATTGATAAAAAGTCAGAGTTAAGAGAGCGATTTATAACATCAGATGATGCTTGGGATATGATGACATCTAAGACAACCGTAGTGATTGTTGATACGCATAAACCGGAACTGGTTTTAGATGAAAATGTCTTAAATAAAGCAAACCGTAAAGTTGTTATCGATCATCATAGACGTGGTGAAAGCTTCATCTCTAATCCATTGTTGATATATATGGAACCATACGCAAGTTCAACAGCTGAATTGGTAACAGAGTTACTGGAATATCAACCAACAGAACAACGTTTAACACGTCTTGAATCAACAGTGATGTATGCAGGTATTATTGTAGATACAAGAAACTTTACATTACGAACAGGATCAAGAACATTCGATGCAGCGAGTTATTTACGTGCACATGGTGCAGATACGATTTTAACGCAACATTTCTTAAAAGATGATGTGGATACTTACATTAATCGATCTGAATTAATTCGAACTGTAAAAGTTGAAGATAATGGCATAGCCATTGCGCATGGTTCAGACGATAAAATTTATCATCCAGTAACAGTTGCACAAGCAGCAGATGAACTGTTAAGTTTAGAAGGTATTGAAGCATCATATGTTGTTGCGAGACGTGAAGATAATCTGATTGGTATATCTGCGCGTTCACTCGGTTCAGTAAATGTTCAGTTAACAATGGAAGCACTTGGTGGCGGTGGACATTTAACCAATGCTGCAACACAACTTAAAGGTGTGACAGTCGAAGAGGCGATAGCACAATTACAACAAGCAATTACAGAACAATTAAGTAGGAGTGAAGATGCATGA
DHH family phosphoesterase6554.9442773769.6-0.109008Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR0296617.8PF01368DHHDHH familyCL0137HAD79.1Cytoplasmicno predicted signal peptide2447004384WP_001081640
MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMKMDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTNHMEANVISESVNEVFPNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFLDNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEESKFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSINGNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRFAMMNNLEAYIVLNETDIDPTLRRVMNEIDKKSELRERFITSDDAWDMMTSKTTVVIVDTHKPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQRLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINRSELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGISARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
no data available
SA_RS00215SA0014S. aureus N315SAUPAN000025000rplICDSSA_RS0021550S ribosomal protein L9chromosome+2029220738447unknownWP_000864305
ATGAAAGTAATTTTTACACAAGATGTTAAAGGTAAAGGTAAAAAAGGTGAAGTTAAAGAAGTACCAGTAGGTTATGCAAATAACTTCTTATTGAAAAAGAATTATGCTGTAGAAGCAACACCAGGTAACCTTAAACAATTAGAGTTACAGAAAAAACGTGCAAAACAAGAACGCCAACAAGAAATTGAAGATGCTAAAGCATTAAAAGAAACGTTATCAAACATTGAAGTTGAAGTATCAGCAAAAACTGGTGAAGGTGGTAAATTGTTTGGATCAGTAAGTACAAAACAAATTGCCGAAGCACTAAAAGCACAACATGATATTAAAATTGATAAACGTAAAATGGATTTACCAAATGGAATTCATTCCCTAGGATATACGAATGTACCTGTTAAATTAGATAAAGAAGTTGAAGGTACAATTCGCGTACACACAGTTGAACAATAA
50S ribosomal protein L914810.065416453.8-0.681757Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL9TIGR00158149.7PF03948Ribosomal_L9_CRibosomal protein L9, C-terminal domainno clan definedno clan defined98.6
SA_RS02405; SA_RS02905; SA_RS02915; SA_RS08560; SA_RS11760
Cytoplasmicno predicted signal peptide0446787049WP_000864305
MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
no data available 21166474
SA_RS00220SA0015S. aureus N315SAUPAN000026000dnaCCDSSA_RS00220replicative DNA helicasechromosome+20770221701401unknownWP_000375647
ATGGATAGAATGTATGAGCAAAATCAAATGCCACATAACAATGAAGCTGAACAGTCTGTCTTAGGTTCAATTATTATAGATCCAGAATTGATTAATACTACTCAGGAAGTTTTGCTTCCTGAGTCGTTTTATAGGGGTGCCCATCAACATATTTTCCGTGCAATGATGCACTTAAATGAAGATAATAAAGAAATTGATGTTGTAACATTGATGGATCAATTATCGACGGAAGGTACGTTGAATGAAGCGGGTGGCCCGCAATATCTTGCAGAGTTATCTACAAATGTACCAACGACGCGAAATGTTCAGTATTATACTGATATCGTTTCTAAGCATGCATTAAAACGTAGATTGATTCAAACTGCAGATAGTATTGCCAATGATGGATATAATGATGAACTTGAACTAGATGCGATTTTAAGTGATGCAGAACGTCGAATTTTAGAGCTATCATCTTCTCGTGAAAGCGATGGCTTTAAAGACATTCGAGACGTCTTAGGACAAGTGTATGAAACAGCTGAAGAGCTTGATCAAAATAGTGGTCAAACACCAGGTATACCTACAGGATATCGAGATTTAGACCAAATGACAGCAGGGTTCAACCGAAATGATTTAATTATCCTTGCAGCGCGTCCATCTGTAGGTAAGACTGCGTTCGCACTTAATATTGCACAAAAAGTTGCAACGCATGAAGATATGTATACAGTTGGTATTTTCTCACTAGAGATGGGTGCTGATCAGTTAGCCACACGTATGATTTGTAGTTCTGGTAATGTTGACTCAAACCGCTTAAGAACGGGTACTATGACTGAGGAAGATTGGAGTCGTTTTACTATAGCGGTAGGTAAATTATCACGTACGAAGATTTTTATTGATGATACACCGGGTATTCGAATTAATGATTTACGTTCTAAATGTCGTCGATTAAAGCAAGAACATGGCTTAGACATGATTGTGATTGACTACTTACAGTTGATTCAAGGTAGTGGTTCACGTGCGTCCGATAACAGACAACAGGAAGTTTCTGAAATCTCTCGTACATTAAAAGCATTAGCCCGTGAATTAGAATGTCCAGTTATCGCATTAAGTCAGTTATCTCGTGGTGTTGAACAACGACAAGATAAACGTCCAATGATGAGTGATATTCGTGAATCTGGTTCGATTGAGCAAGATGCCGATATCGTTGCATTCTTATACCGTGATGATTACTATAACCGTGGCGGCGATGAAGATGATGACGATGATGGTGGTTTCGAGCCACAAACGAATGATGAAAACGGTGAAATTGAAATTATCATTGCTAAGCAACGTAACGGTCCAACAGGCACAGTTAAGTTACACTTTATGAAACAATATAATAAATTTACCGATATCGATTATGCACATGCAGATATGATGTAA
replicative DNA helicase4664.4176752571.3-0.5907733.6.4.12Genetic information processingDNA metabolismDNA replication, recombination, and repairreplicative DNA helicaseTIGR00665585.3PF03796DnaB_CDnaB-like helicase C terminal domainCL0023P-loop_NTPase383.9
SA_RS08545; SA_RS11680
Cytoplasmicno predicted signal peptide0446297792WP_000375647
MDRMYEQNQMPHNNEAEQSVLGSIIIDPELINTTQEVLLPESFYRGAHQHIFRAMMHLNEDNKEIDVVTLMDQLSTEGTLNEAGGPQYLAELSTNVPTTRNVQYYTDIVSKHALKRRLIQTADSIANDGYNDELELDAILSDAERRILELSSSRESDGFKDIRDVLGQVYETAEELDQNSGQTPGIPTGYRDLDQMTAGFNRNDLIILAARPSVGKTAFALNIAQKVATHEDMYTVGIFSLEMGADQLATRMICSSGNVDSNRLRTGTMTEEDWSRFTIAVGKLSRTKIFIDDTPGIRINDLRSKCRRLKQEHGLDMIVIDYLQLIQGSGSRASDNRQQEVSEISRTLKALARELECPVIALSQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNRGGDEDDDDDGGFEPQTNDENGEIEIIIAKQRNGPTGTVKLHFMKQYNKFTDIDYAHADMM
no data available 21166474
SA_RS14385S. aureus N315CDSSA_RS14385hypothetical proteinchromosome-2226222447186unknownWP_078061228
GTGAGCACCTCCAAGTTTTTCTCATTTAACCATTTGATATTCTACCAATATCGAGACCATAATGCAAATAAAAATCGAACATTGATTTTCGGCCTTTTTAAAAGAAAAATCATTTTAACAAATCGTCTTCAACGTCCTAAAAACCCTTTAACAGAGGCGTTGACAGTACTAATTTATCACTTTTAA
hypothetical protein6111.32727417.64-0.291803Cytoplasmic Membraneno predicted signal peptide0WP_078061228
MSTSKFFSFNHLIFYQYRDHNANKNRTLIFGLFKRKIILTNRLQRPKNPLTEALTVLIYHF
no data available
SA_RS00225SA0016S. aureus N315SAUPAN000028000purACDSSA_RS00225adenylosuccinate synthetasechromosome+22448237311284unknownWP_000095328
ATGTCATCAATCGTAGTAGTTGGGACACAATGGGGAGACGAAGGAAAAGGAAAAATAACGGATTTCTTGGCAGAACAGTCAGATGTTATCGCGCGTTTTTCAGGTGGTAATAATGCAGGCCATACCATTCAATTTGGCGGAGAAACATATAAATTACATTTAGTACCATCTGGTATCTTTTACAAAGACAAATTAGCGGTAATCGGTAACGGTGTCGTTGTTGATCCAGTTGCACTATTGAAAGAATTAGACGGATTAAATGAACGTGGCATTCCTACAAGTAATTTACGTATATCTAATCGTGCGCAAGTGATTTTACCATATCACTTAGCACAAGATGAATATGAAGAACGTTTACGCGGTGACAATAAGATTGGTACAACTAAAAAAGGTATCGGTCCAGCATATGTAGACAAAGTTCAACGTATCGGTATTCGTATGGCAGATTTACTTGAAAAAGAAACATTCGAAAGATTATTAAAATCAAACATTGAATATAAACAAGCATATTTCAAAGGTATGTTTAACGAAACATGTCCATCATTTGATGATATCTTTGAAGAATACTATGCTGCAGGTCAACGTTTAAAAGAATTTGTAACAGACACATCAAAAATCTTAGACGATGCATTTGTAGCAGATGAAAAGGTACTTTTCGAAGGTGCGCAAGGTGTAATGTTAGATATCGACCATGGTACATATCCATTCGTTACATCAAGTAATCCAATTGCAGGTAACGTTACTGTTGGTACAGGTGTAGGTCCTACATTCGTTTCGAAGGTAATTGGTGTATGTAAAGCTTATACATCACGTGTTGGTGATGGTCCATTCCCTACTGAATTATTCGATGAAGATGGACATCATATTAGAGAAGTTGGTCGTGAATACGGTACAACAACAGGACGTCCACGTCGTGTAGGTTGGTTTGACTCAGTTGTATTACGTCACTCTCGTCGTGTAAGTGGTATTACAGATTTATCTATTAACTCAATCGATGTTTTAACAGGCCTAGACACAGTGAAAATCTGTACAGCTTATGAATTAGACGGTAAAGAAATTACTGAGTACCCAGCAAACTTAGATCAATTAAAACGTTGTAAACCAATCTTTGAAGAGTTACCAGGTTGGACAGAAGACGTAACAAGTGTGCGTACTTTAGAAGAATTACCTGAAAATGCACGTAAATATTTAGAGCGTATTTCAGAATTATGTAATGTACAAATTTCTATCTTCTCAGTTGGTCCAGATAGAGAACAAACAAACCTATTAAAAGAATTGTGGTAG
adenylosuccinate synthetase4274.8564547551.4-0.3002346.3.4.4MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisadenylosuccinate synthaseTIGR00184594.6PF00709Adenylsucc_syntAdenylosuccinate synthetaseCL0023P-loop_NTPase587.6
SA_RS00215; SA_RS00690; SA_RS01275; SA_RS02015; SA_RS02025; SA_RS02095; SA_RS02130; SA_RS02145; SA_RS02710; SA_RS02810; SA_RS02905; SA_RS02910; SA_RS02915; SA_RS02920; SA_RS02935; SA_RS02945; SA_RS02950; SA_RS02955; SA_RS02960; SA_RS03155; SA_RS03380; SA_RS04020; SA_RS04140; SA_RS04145; SA_RS04150; SA_RS04160; SA_RS04325; SA_RS04420; SA_RS04575; SA_RS04660; SA_RS04680; SA_RS04710; SA_RS04915; SA_RS04935; SA_RS05295; SA_RS05300; SA_RS05350; SA_RS05360; SA_RS05365; SA_RS05620; SA_RS05860; SA_RS06095; SA_RS06125; SA_RS06140; SA_RS06225; SA_RS06235; SA_RS06315; SA_RS06490; SA_RS06645; SA_RS06690; SA_RS06730; SA_RS07060; SA_RS07120; SA_RS07360; SA_RS07385; SA_RS07400; SA_RS07605; SA_RS07820; SA_RS07955; SA_RS08285; SA_RS08295; SA_RS08435; SA_RS08460; SA_RS08470; SA_RS08505; SA_RS08545; SA_RS08560; SA_RS08565; SA_RS08580; SA_RS08675; SA_RS08760; SA_RS09005; SA_RS09400; SA_RS09810; SA_RS09850; SA_RS09855; SA_RS10535; SA_RS11010; SA_RS11050; SA_RS11075; SA_RS11145; SA_RS11245; SA_RS11430; SA_RS11605; SA_RS11630; SA_R
Cytoplasmicno predicted signal peptide0446017473WP_000095328
MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTSVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELW
no data available 21166474
SA_RS00230SAtRNA01S. aureus N315SAUPAN000029000trnaEtRNASA_RS00230tRNA-Gluchromosome+241602423475unknown
GGCTCCTTGGTCAAGCGGTTAAGACACCGCCCTTTCACGGCGGTAACACGGGTTCGAGTCCCGTAGGAGTCACCA
tRNA-Glu0no predicted signal peptideno data available
SA_RS00235SAtRNA02S. aureus N315SAUPAN000030000trnaDtRNASA_RS00235tRNA-Aspchromosome+242422431473unknown
GGTCTCGTAGTGTAGCGGTTAACACGCCTGCCTGTCACGCAGGAGATCGCGGGTTCGATTCCCGTCGAGACCG
tRNA-Asp0no predicted signal peptideno data available
SA_RS00240SA0017S. aureus N315SAUPAN000032000walRCDSSA_RS00240DNA-binding response regulatorchromosome+2493425635702unknownWP_000101976
ATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTTAACTTAAAAAAAGAAGGATACGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGACTTAATTTATGAAGAAGAACCAGACATCGTATTACTAGATATCATGTTACCTGGTCGTGATGGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATAATAATGCTTACTGCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTAACGAAACCGTTTAGTACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCATTACTCACAACCAGCACAAGACACTGGAAATGTAACGAATGAAATCACAATTAAAGATATTGTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTAACACATCGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAACATTTATTACAAACAGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTAACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGTCACATCCTGAATATATTGTGACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG
DNA-binding response regulator2334.8121127191.8-0.475536Signal transductionRegulatory functions; Signal transductionDNA interactions; Two-component systemsphosphate regulon transcriptional regulatory protein PhoBTIGR02154235.8PF00072Response_regResponse regulator receiver domainCL0304CheY103.1
SA_RS02405; SA_RS02710; SA_RS05360; SA_RS06225; SA_RS07400; SA_RS11010; SA_RS11735; SA_RS13735
Cytoplasmicno predicted signal peptide0446024121WP_000101976
MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
no data available 21166474
SA_RS00245SA0018S. aureus N315SAUPAN000033000walKCDSSA_RS00245cell wall metabolism sensor histidine kinase WalKchromosome+25648274741827unknownWP_000871607
ATGAAGTGGCTAAAACAACTACAATCCCTTCATACTAAACTTGTAATTGTTTATGTATTACTGATTATCATTGGTATGCAAATTATCGGGCTGTATTTTACAAATAATCTTGAAAAAGAGCTGCTTGATAATTTTAAGAAGAATATTACGCAGTACGCTAAACAATTAGAAATTAGTATTGAAAAAGTATATGACGAAAAGGGCTCCGTAAATGCACAAAAAGATATTCAAAATTTATTAAGTGAGTATGCCAACCGTCAAGAAATTGGAGAAATTCGTTTTATAGATAAAGACCAAATTATTATTGCGACGACGAAGCAGTCTAACCGTAGTCTAATCAATCAAAAAGCGAATGATAGTTCTGTCCAAAAAGCACTATCACTAGGACAATCAAACGATCATTTAATTTTAAAAGATTATGGCGGTGGTAAGGACCGTGTCTGGGTATATAATATCCCAGTTAAAGTCGATAAAAAGGTAATTGGTAATATTTATATCGAATCAAAAATTAATGACGTTTATAACCAATTAAATAATATAAATCAAATATTCATTGTTGGTACAGCTATTTCATTATTAATCACAGTCATCCTAGGATTCTTTATAGCGCGAACGATTACCAAACCAATCACCGATATGCGTAACCAGACGGTCGAAATGTCCAGAGGTAACTATACGCAACGTGTGAAGATTTATGGTAATGATGAAATTGGCGAATTAGCTTTAGCATTTAATAACTTGTCTAAACGTGTACAAGAAGCGCAGGCTAATACTGAAAGTGAGAAACGTAGACTGGACTCAGTTATCACCCATATGAGTGATGGTATTATTGCAACAGACCGCCGTGGACGTATTCGTATCGTCAATGATATGGCACTCAAGATGCTTGGTATGGCGAAAGAAGACATCATCGGATATTACATGTTAAGTGTATTAAGTCTTGAAGATGAATTTAAACTTGAAGAAATTCAAGAGAATAATGATAGTTTTTTATTAGATTTAAATGAAGAAGAAGGTCTAATCGCACGTGTTAACTTTAGTACGATTGTGCAGGAAACAGGATTTGTAACTGGTTATATCGCTGTGTTACATGACGTTACTGAACAACAACAAGTTGAACGTGAGCGTCGTGAATTTGTTGCCAATGTATCACATGAGTTACGTACACCTTTAACTTCTATGAATAGTTACATTGAAGCACTTGAAGAAGGTGCATGGAAAGATGAGGAACTTGCGCCACAATTTTTATCTGTTACCCGTGAAGAAACAGAACGAATGATTCGACTGGTCAATGACTTGCTACAGTTATCTAAAATGGATAATGAGTCTGATCAAATCAACAAAGAAATTATCGACTTTAACATGTTCATTAATAAAATTATTAATCGACATGAAATGTCTGCGAAAGACACAACATTTATTCGAGATATTCCGAAAAAGACGATTTTCACAGAATTTGATCCTGATAAAATGACGCAAGTATTCGATAATGTCATTACAAATGCGATGAAATATTCTAGAGGCGATAAACGTGTCGAGTTCCACGTGAAACAAAATCCACTTTATAATCGAATGACGATTCGTATTAAAGATAATGGCATCGGTATTCCTATCAATAAAGTCGATAAGATATTCGACCGATTCTATCGTGTAGATAAGGCACGTACGCGTAAAATGGGTGGTACTGGATTAGGACTAGCCATTTCGAAAGAGATTGTGGAAGCGCACAATGGTCGTATTTGGGCAAACAGTGTAGAAGGTCAAGGTACATCTATCTTTATCACACTTCCATGTGAAGTCATTGAAGACGGTGATTGGGATGAATAA
cell wall metabolism sensor histidine kinase WalK6085.3988369923.5-0.3537832.7.13.3Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR02966248PF02518HATPase_cHistidine kinase-, DNA gyrase B-, and HSP90-like ATPaseCL0025His_Kinase_A92.8
SA_RS00240; SA_RS06225; SA_RS11680
Cytoplasmic Membraneno predicted signal peptide2446794351WP_000871607
MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNINQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEVIEDGDWDE
no data available 21166474
SA_RS00250SA0019S. aureus N315SAUPAN000034000walHCDSSA_RS00250hypothetical proteinchromosome+27467288011335unknownWP_001060140
ATGAATAATAAGGAACATATTAAATCTGTCATTTTAGCGCTACTCGTCTTGATGAGTGTCGTATTGACATATATGGTATGGAACTTTTCTCCTGATATTGCAAATGTCGACAATACAGATAGTAAGAAGAGTGAAACGAAACCTTTAACGACACCTATGACAGCCAAAATGGATACAACTATTACGCCATTTCAGATTATTCATTCGAAAAATGATCATCCAGAAGGTACGATTGCGACGGTATCTAATGTGAATAAACTGACGAAACCTTTGAAAAATAAAGAAGTGAAGTCCGTGGAACATGTTCGTCGTGATCATAACTTGATGATTCCGGATTTAAGCAGTGATTTTACATTATTCGATTTTACGTATGATTTACCGTTATCAACATATCTTGGCCAAGTACTGAACATGAATGCGAAAGTACCAAATCATTTCAATTTCAATCGTTTAGTCATAGATCATGATGCTGATGATAATATCGTGCTTTATGCTATAAGTAAAGACCGCCACGATTACGTAAAATTAACAACTACAACGAAAAATGATCATTTTTTAGATGCATTAGCAGCAGTGAAAAAAGATATGCAACCATACACAGATATCATCACAAACAAAGATACAATTGATCGTACGACGCATGTTTTTGCACCAAGTAAACCTGAAAAGTTAAAAACATATCGCATGGTATTTAACACGATTAGTGTTGAGAAAATGAATGCTATACTATTTGACGATTCAACCATCGTTCGTAGTTCAAAGAGTGGTGTTACAACCTACAACAATAATACAGGTGTCGCAAACTATAACGATAAAAATGAAAAATATCATTATAAAAACCTGTCCGAAGATGAAGCAAGTTCCAGCAAAATGGAAGAAACGATTCCAGGAACCTTTGATTTTATTAATGGTCATGGTGGTTTCTTAAACGAAGACTTCAGATTGTTTAGTACGAATAATCAGTCAGGCGAGTTAACATATCAACGTTTCCTTAACGGTTATCCAACGTTTAATAAAGAAGGCTCTAATCAAATTCAAGTCACTTGGGGTGAAAAAGGCGTCTTTGATTATCGTCGTTCGTTATTGCGCACCGACGTTGTGTTAAATAGTGAGGATAATAAAACGTTGCCGAAATTAGAGTCTGTACGTTCAAGCTTAGCGAACAATAGTGATATTAATTTTGAAAAAGTAACAAACATCGCTATCGGTTACGAAATGCAGGATAACTCAGATCATAATCACATTGAAGTGCAGATTAACAGTGAACTCGTACCGCGTTGGTATGTAGAATATGATGGTGAATGGTATGTTTATAACGATGGGAGGCTTGAATAA
hypothetical protein4445.7407150899.6-0.590766Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein CTIGR0171316.7PF07435YycHYycH proteinCL0285YycI_YycH448.3no significant predictionno predicted signal peptide1446982884WP_001060140
MNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTTPMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIPDLSSDFTLFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRHDYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVFNTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKMEETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGEKGVFDYRRSLLRTDVVLNSEDNKTLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSDHNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
no data available
SA_RS00255SA0020S. aureus N315SAUPAN000035000walICDSSA_RS00255hypothetical proteinchromosome+2880229590789unknownWP_001104165
ATGAACTGGAAACTGACAAAGACACTTTTCATTTTCGTGTTTATTCTTGTCAACATCGTGTTAGTATCGATTTATGTTAATAAAGTCAATCGCTCACACATTAATGAAGTTGAGAGTAACAATGAAGTTAATTTTCAGCAAGAAGAAATTAAAGTACCGGCTAGTATATTGAATAAATCAGTTAAAGGTATAAAATTAGAGCAAATTACAGGGCGATCAAAAGACTTTAGTTCTAAAGCTAAGGGCGATTCGGATTTGACCACATCAGATGGTGGAAAATTATTGAATGCGAACATTAGTCAATCGGTAAAGGTCAGTGACAATAACTTAAAAGATTTGAAAGATTATGTTAACAAACGTGTGTTCAAAGGTTCAGAATATCAATTAAGTGAAATTAATTCTGGTTCTGTAAAATACGAACAAACGTATGATAATTTCCCGATTTTGAACAATAGTAAAGCGATGTTGAACTTTAATATAGAAGATAACAAAGCGGCTAGTTATAAACAATCAATGATGGATGACATTAAGCCCACAGATGGTGCAGATAAGAAGCATCAAGTTATTGGAGTGAGAAAAGCAATCGAGGCATTATATTATAATCGTTACTTGAAAAAAGGTGATGAAGTCATTAATGCTAGACTCGGTTACTACTCAGTCGTGAACGAAACGAATGTTCAATTGTTACAACCAAACTGGGAAATTAAAGTGAAGCATGACGGTAAGGACAAAACGAATACTTACTATGTCGAAGCGACAAATAATAACCCTAAAATTATTAATCATTAA
hypothetical protein2629.6126329855.6-0.611069PF09648YycIYycH proteinCL0285YycI_YycH171.4no significant predictionno predicted signal peptide1447026909WP_001104165
MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPASILNKSVKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKRVFKGSEYQLSEINSGSVKYEQTYDNFPILNNSKAMLNFNIEDNKAASYKQSMMDDIKPTDGADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHDGKDKTNTYYVEATNNNPKIINH
no data available
SA_RS00260SA0021S. aureus N315SAUPAN000036000walJCDSSA_RS00260MBL fold metallo-hydrolasechromosome+2997930779801unknownWP_000088649
ATGAGCCGCTTGATACGCATGAGTGTATTAGCAAGTGGTAGTACAGGTAACGCCACTTTTGTAGAAAATGAAAAAGGTAGTCTATTAGTTGATGTTGGTTTGACTGGCAAGAAAATGGAAGAATTGTTTAGTCAAATTGACCGTAATATTCAAGATTTAAATGGTATTTTAGTAACCCATGAACATATTGATCATATTAAAGGATTAGGTGTTTTGGCGCGTAAATATCAATTGCCAATTTATGCGAATGAAAAGACTTGGCAGGCAATTGAAAAGAAAGATAGTCGCATCCCTATGGATCAGAAATTCATTTTTAATCCTTATGAAACAAAATCTATTGCAGGTTTCGATGTTGAATCGTTTAACGTGTCACATGATGCAATAGATCCGCAATTTTATATTTTCCATAATAACTATAAGAAGTTTACGATTTTAACGGATACGGGTTACGTGTCTGATCGTATGAAAGGTATGATACGTGGCAGCGATGCGTTTATTTTTGAGAGTAATCATGACGTCGATATGTTGAGAATGTGTCGTTATCCATGGAAGACGAAACAACGTATTTTAGGCGATATGGGTCATGTATCTAATGAGGATGCGGGTCATGCGATGACAGATGTGATTACAGGTAACACGAAACGTATTTACCTATCGCATTTATCACAAGACAATAACATGAAAGATTTGGCGCGTATGAGTGTTGGCCAAGTATTGAACGAACACGATATTGATACGGAAAAAGAAGTATTGCTATGTGATACGGATAAAGCTATTCCAACGCCAATATATACAATATAA
MBL fold metallo-hydrolase2666.3490430313.3-0.405639Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341333.4PF00753Lactamase_BMetallo-beta-lactamase superfamilyCL0381Metallo-HOrase80.1Cytoplasmicno predicted signal peptide0446010794WP_000088649
MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTHEHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVESFNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCRYPWKTKQRILGDMGHVSNEDAGHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLNEHDIDTEKEVLLCDTDKAIPTPIYTI
no data available
SA_RS00265SA0022S. aureus N315SAUPAN000037000adsACDSSA_RS00265multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase/3'-nucleotidasechromosome+31006333242319unknownWP_000645787
ATGAAAGCTTTATTACTTAAAACAAGTGTATGGCTCGTTTTGCTTTTTAGTGTGATGGGATTATGGCAAGTCTCGAACGCGGCTGAGCAGTATACACCAATCAAAGCACATGTAGTAACAACGATAGACAAAGCAACAACAGATAAGCAACAAGTAACGCCAACAAAGGAAGCGGCTCATCAATTTGGTGAAGAAGCGGCAACCAACGTATCAGCATCAGCACAGGGAACAGCTGATGAAATAAACAATAAAGTAACATCCAACGCATTTTCTAACAAACCATCTACAGCAGTTTCAACAAAAGTAAACGAAACGCACGATGTAGATACACAACAAGCCTCAACACAAAAACCAACTCAATCAGCAACATTCACATTATCAAATGCTAAAACAGCATCACTTTCACCACGAATGTTTGCTGCCAATGTACCACAAACAACAACACATAAAATATTACATACAAATGATATCCATGGCCGACTAGCCGAAGAAAAAGGGCGTGTCATCGGTATGGCTAAATTAAAAACAATAAAAGAACAAGAAAAGCCTGATTTAATGTTAGACGCAGGAGACGCCTTCCAAGGTTTACCACTTTCAAACCAGTCTAAAGGTGAAGAAATGGCTAAAGCAATGAATGCAGTAGGTTATGATGCTATGGCAGTGGGTAACCATGAATTTGACTTTGGATACGATCAGTTGAAAAAGTTAGAGGGTATGTTAGACTTCCCGATGCTAAGTACTAACGTTTACAAAGATGGGAAACGCGCGTTTAAGCCTTCAACAATTGTAACGAAAAATGGTATTCGTTATGGAATTATTGGCGTAACGACACCAGAAACAAAGACGAAAACAAGACCTGAGGGCATTAAAGGTGTTGAATTTAGAGATCCATTACAAAGTGTGACAGCAGAAATGATGCGTATTTATAAAGACGTAGATACATTTGTTGTTATATCACATTTAGGGATTGATCCTTCAACACAAGAAACATGGCGTGGTGATTACTTAGTGAAACAATTAAGTCAAAATCCACAATTGAAGAAACGTATTACAGTCATTGATGGTCATTCACATACCGTACTTCAAAATGGTCAAATTTATAACAATGATGCATTAGCACAAACAGGTACAGCACTTGCGAATATCGGTAAGGTTACATTTAATTACCGCAATGGAGAGGTATCAAATATTAAACCGTCATTGATTAATGTTAAAGACGTTGAAAATGTAACACCGAACAAAGCATTAGCTGAACAAATTAATCAAGCTGATCAAACATTTAGAGCACAAACAGCAGAGGTTATTATTCCAAATAATACCATTGATTTCAAAGGAGAAAGAGATGACGTTAGAACGCGTGAAACAAATTTAGGAAACGCGATTGCAGATGCTATGGAAGCGTATGGCGTTAAGAATTTCTCTAAAAAGACTGACTTTGCCGTGACAAATGGTGGAGGTATTCGTGCCTCTATCGCAAAAGGTAAGGTGACACGCTATGATTTAATCTCAGTATTACCATTTGGAAATACGATTGCGCAAATTGATGTAAAAGGTTCAGACGTCTGGACAGCTTTCGAACATAGTTTAGGTGCACCAACAACACAAAAAGACGGTAAGACAGTATTAACAGCGAATGGCGGTTTACTACATATCTCTGATTCAATTCGTGTTTACTATGATATGAATAAACCGTCTGGCAAACGAATTAACGCTATTCAAATTTTAAATAAAGAGACAGGTAAGTTTGAAAATATTGATTTAAAACGTGTATATCATGTAACGATGAATGACTTCACAGCATCAGGTGGCGACGGATATAGTATGTTCGGTGGCCCTAGAGAAGAAGGTATTTCATTAGATCAAGTACTAGCAAGTTATTTAAAAACAGCTAACATAGCTAAGTATGATACGACAGAACCACAACGTATGTTATTAGGTAAACCAGCAGTAAGTGAACAACCAGCTAAAGGACAACAAGGTAGCAAAGGTAGTGAGTCTGGTAAAGATGTACAACCAATTGGTGACGACAAAGCGATGAATCCAGCGAAACAACCAGCGACAGGTAAAGTTGTATTGTTACCAACGCATAGAGGAACTGTTAGTAGCGGTACAGAAGGTTCTGGTCGCACATTAGAAGGAGCTACTGTATCAAGCAAGAGTGGGAACCAATTGGTTAGAATGTCAGTGCCTAAAGGTAGCGCGCATGAGAAACAGTTACCAAAAACTGGAACTAATCAAAGCTCAAGCCCAGCAGCGATGTTTGTATTAGTAGCAGGTATAGGTTTAATCGCGACTGTACGACGTAGAAAAGCTAGTTAA
multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase/3'-nucleotidase7729.8240483497.9-0.448964MetabolismBiosynthesis of cofactors, prosthetic groups, and carriers; Transport and binding proteinsPyridine nucleotides; OtherNAD nucleotidaseTIGR01530135.2PF028725_nucleotid_C5'-nucleotidase, C-terminal domainno clan definedno clan defined141.2Cellwallsignal peptide predicted1446568441WP_000645787
MKALLLKTSVWLVLLFSVMGLWQVSNAAEQYTPIKAHVVTTIDKATTDKQQVTPTKEAAHQFGEEAATNVSASAQGTADEINNKVTSNAFSNKPSTAVSTKVNETHDVDTQQASTQKPTQSATFTLSNAKTASLSPRMFAANVPQTTTHKILHTNDIHGRLAEEKGRVIGMAKLKTIKEQEKPDLMLDAGDAFQGLPLSNQSKGEEMAKAMNAVGYDAMAVGNHEFDFGYDQLKKLEGMLDFPMLSTNVYKDGKRAFKPSTIVTKNGIRYGIIGVTTPETKTKTRPEGIKGVEFRDPLQSVTAEMMRIYKDVDTFVVISHLGIDPSTQETWRGDYLVKQLSQNPQLKKRITVIDGHSHTVLQNGQIYNNDALAQTGTALANIGKVTFNYRNGEVSNIKPSLINVKDVENVTPNKALAEQINQADQTFRAQTAEVIIPNNTIDFKGERDDVRTRETNLGNAIADAMEAYGVKNFSKKTDFAVTNGGGIRASIAKGKVTRYDLISVLPFGNTIAQIDVKGSDVWTAFEHSLGAPTTQKDGKTVLTANGGLLHISDSIRVYYDMNKPSGKRINAIQILNKETGKFENIDLKRVYHVTMNDFTASGGDGYSMFGGPREEGISLDQVLASYLKTANIAKYDTTEPQRMLLGKPAVSEQPAKGQQGSKGSESGKDVQPIGDDKAMNPAKQPATGKVVLLPTHRGTVSSGTEGSGRTLEGATVSSKSGNQLVRMSVPKGSAHEKQLPKTGTNQSSSPAAMFVLVAGIGLIATVRRRKAS
no data available
SA_RS00270SA0023S. aureus N315SAUPAN000040000orfXCDSSA_RS0027023S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmHchromosome+3369234171480unknownWP_000704775
ATGAAAATCACCATTTTAGCTGTAGGGAAACTAAAAGAGAAATATTGGAAGCAAGCCATAGCAGAATATGAAAAACGTTTAGGCCCATACACCAAGATAGACATCATAGAAGTTCCAGACGAAAAAGCACCAGAAAATATGAGCGACAAAGAAATTGAGCAAGTAAAAGAAAAAGAAGGCCAACGAATACTAGCCAAAATTAAACCACAATCCACAGTCATTACATTAGAAATACAAGGAAAGATGCTATCTTCCGAAGGATTGGCCCAAGAATTGAACCAACGCATGACCCAAGGGCAAAGCGACTTTGTATTCGTCATTGGCGGATCAAACGGCCTGCACAAGGACGTCTTACAACGCAGTAACTACGCACTATCATTCAGCAAAATGACATTCCCACATCAAATGATGCGGGTTGTGTTAATTGAGCAAGTGTATAGAGCATTTAAGATTATGCGTGGAGAAGCATATCATAAATGA
23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH1599.8588518306.2-0.4616352.1.1.177Genetic information processingProtein synthesistRNA and rRNA base modificationrRNA large subunit m3Psi methyltransferase RlmHTIGR00246186.6PF02590SPOUT_MTasePredicted SPOUT methyltransferaseCL0098SPOUT206.9Cytoplasmicno predicted signal peptide0446627429WP_000704775
MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
no data available
SA_RS00275SA0024S. aureus N315SAUPAN000041000-CDSSA_RS00275hypothetical proteinchromosome+34493357491257unknownWP_000566670
ATGATAGACAACTTTATGCAGGTCCTTAAATTAATTAAAGAGAAACGTACCAATAATGTAGTTAAAAAATCTGATTGGGATAAAGGTGATCTATATAAAACTTTAGTCCATGATAAGTTACCCAAGCAGTTAAAAGTGCATATAAAAGAAGATAAATATTCAGTTGTAGGGAAGGTTGCTACTGGGAACTATAGTAAAGTTCCTTGGATTTCAATATATGATGAGAATATAACAAAAGAAACAAAGGATGGATATTATTTGGTATATCTTTTTCATCCGGAAGGAGAAGGCATATACTTATCTTTGAATCAAGGATGGTCAAAGATAAGTGATATGTTTCCGCGGGATAAAAATGCTGCAAAACAAAGAGCATTAACTTTATCTTCCGAACTCAATAAATATATTACATCAAATGAATTTAATACTGGAAGATTTTATTACGCAGAAAATAAAGATTCATCTTATGATTTAAAAAATGATTATCCATCAGGATATTCTCATGGATCAATAAGATTCAAATATTATGATTTGAATGAAGGATTCACAGAAGAAGATATGCTAGAGGATTTAAAGAAATTTTTAGAACTATTTAATGAATTAGCTTCAAAAGTTACAAAAACATCCTATGATAGCTTGGTCAATAGCATAGACGAAATACAGGAAGACAGCGAAATTGAAGAAATTAGAACAGCACAAAAAGATAAGACACTCAAGGAAGTGGAAGCACCTAAAGGAATAATTCCAAAATATAAAAAAGGTGTATCAAAGACTACTAAAAATGATTCAGAAATTGAAAAATCAAATAAAGAGAATAAATTAACCGGTAAAGTTGGAGAAAAATTAGCGCTAAATTACTTTAATGAGCTAATTGATAATAAAATAGACGAAGATAAGAAAGAACAGTTTAGGAATATTTTAAATGATAATCCAGGCTCTCAACACGGTCATGGCTATGATTTAGTAGCTTTTGATCCAACAAATACAGATAAAGCTGTAGAAAAATTTATTGAAATTAAAACATCTACATCTTCTAGTATTGAGGAACCATTTTTTATGTCGCTAAATGAAATGTTTGCTATGAAAGAATATAAGCAGAAATATTTAATATTAAGAATATTTAATGTTTCCGGTAAAGAACCACAATTTTATTTTATAGATCCATATGCAAATTATTCTGAATTTAAAGATGTAGATGATCTCATTGACAAAGTATTTAATGTAGAAGCTATTCAGTATAAAGTTTTTGGCGAAAAATGA
hypothetical protein4185.3285148642.4-0.775359PF12102DUF3578Domain of unknown function (DUF3578)no clan definedno clan defined179.1no significant predictionno predicted signal peptide0446488816WP_000566670
MIDNFMQVLKLIKEKRTNNVVKKSDWDKGDLYKTLVHDKLPKQLKVHIKEDKYSVVGKVATGNYSKVPWISIYDENITKETKDGYYLVYLFHPEGEGIYLSLNQGWSKISDMFPRDKNAAKQRALTLSSELNKYITSNEFNTGRFYYAENKDSSYDLKNDYPSGYSHGSIRFKYYDLNEGFTEEDMLEDLKKFLELFNELASKVTKTSYDSLVNSIDEIQEDSEIEEIRTAQKDKTLKEVEAPKGIIPKYKKGVSKTTKNDSEIEKSNKENKLTGKVGEKLALNYFNELIDNKIDEDKKEQFRNILNDNPGSQHGHGYDLVAFDPTNTDKAVEKFIEIKTSTSSSIEEPFFMSLNEMFAMKEYKQKYLILRIFNVSGKEPQFYFIDPYANYSEFKDVDDLIDKVFNVEAIQYKVFGEK
no data available
SA_RS00280SA0025S. aureus N315SAUPAN000053000-CDSSA_RS00280hypothetical proteinchromosome+3616436403240unknownWP_001282728
ATGAGTGATAATTTGTCATTATTCATTGACTATATCAATGATAATATAATCTATGGTAGTGAAATCAAACGGGAGAAATTAGAGAATTTATTTAATCAATTTGCTATAAAAAATGTTGAAAAGAACATTGTCTATGATGAACTGAAATCTTTAGATATTACAATCATTGAGTCACAGGATTCATATAAAAATAAATTGAAGAGATTATTTTCGGTTCTGTTGCAAAGTAAAAAAATATAG
hypothetical protein796.817089346.71-0.331646phenylacetic acid degradation protein paaNTIGR0228811.6PF17190RecG_NRecG N-terminal helical domainno clan definedno clan defined13.6no significant predictionno predicted signal peptide0447205472WP_001282728
MSDNLSLFIDYINDNIIYGSEIKREKLENLFNQFAIKNVEKNIVYDELKSLDITIIESQDSYKNKLKRLFSVLLQSKKI
no data available
SA_RS00285SA0026S. aureus N315SAUPAN000054000tnpCDSSA_RS00285IS6 family transposase IS431mecchromosome-3643537109675unknownWP_001106057
ATGAACTATTTCAGATATAAACAATTTAACAAGGATGTTATCACTGTAGCCGTTGGCTACTATCTAAGATATACATTGAGTTATCGTGATATATCTGAAATATTAAGGGAACGTGGTGTAAACGTTCATCATTCAACGGTCTACCGTTGGGTTCAAGAATATGCCCCAATTTTGTATCAAATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATCAAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATGCAGAGGGACATACATTAGATATTTGGTTGCGTAAGCAACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTCATTAAACAATTTGGTAAACCTCAAAAGGTAATTACAGATCAGGCACCTTCAACGAAGGTAGCAATGGCTAAAGTAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACATCGAAATATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGGTATCAAAGTATCAATACAGCAAAGAATACTTTAAAAGGTATTGAATGTATTTACGCTCTATATAAAAAGAACCGCAGGTCTCTTCAGATCTACGGATTTTCGCCATGCCACGAAATTAGCATCATGCTAGCAAGTTAA
IS6 family transposase IS431mec22410.42726915.2-0.601339PF13610DDE_Tnp_IS240DDE domainCL0219RNase_H133.2Cytoplasmicno predicted signal peptide0447028801WP_001106057
MNYFRYKQFNKDVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
no data available
SA_RS00295SA0028S. aureus N315SAUPAN000057000truncated repBCDS, pseudogeneSA_RS00295protein repchromosome-3720038183984unknown
ATGTGTCCTAATAGTAGCATTTATTCAGATGAAAAATCAAGGGTTTTAGTGGACAAGACAAAAAGTGGAAAAGTGAGACCATGGAGAGAAAAGAAAATCGCTAATGTTGATTACTTTGAACTTCTGCATATTCTTGAATTTAAAAAGGCTGAAAGAGTAAAAGATTGTGCTGAAATATTAGAGTATAAACAAAATCGTGAAACAGGCGAAAGAAAGTTGTATCGAGTGTGGTTTTGTAAATCCAGGCTTTGTCCAATGTGCAACTGGAGGAGAGCAATGAAACATGGCATTCAGTCACAAAAGGTTGTTGCTGAAGTTATTAAACAAAAGCCAACAGTTCGTTGGTTGTTTCTCACATTAACAGTTAAAAATGTTTATGATGGCGAAGAATTAAATAAGAGTTTGTCAGATATGGCTCAAGGATTTCGCCGAATGATGCAATATAAAAAAATTAATAAAAATCTTGTTGGTTTTATGCGTGCAACGGAAGTGACAATAAATAATAAAGATAATTCTTATAATCAGCACATGCATGTATTGGTATGTGCGGAACCAACTTATTTTAAGAATACAGAAAACTGCGTGAATCAAAAACAATGGATTCAATTTTGGAAAAAGGCAATGAAATTAGACTATGATCCAAATGTAAAAGTTCAAATGATTCGACCGAAAAATAAATATAAATCGGATATACAATCGGCAATTGACGAAACTGCAAAATATCCTGTAAAGGATACGGATTTTATGACCGATGATGAAGAAAAGAATTTGTAACGTTTGTCTGATTTGGAGGAAGGTTTACACCGTAAAAGGTTAATCTCCTATGGTGGTTTGTTAAAAGAAATACATAAAAAATTAAACCTTGATGACACAGAAGAAGGCGATTTGATTCATACAGATGATGACGAAAAAGCCGATGAAGATGGATTTTCTATTATTGCAATGTGGAATTGGGAACGGAAAAATTATTTTATTAAAGAGTAG
protein rep0no predicted signal peptideno data available
SA_RS00300SA0029S. aureus N315SAUPAN000059000preCDSSA_RS00300Plasmid recombination enzyme type 2chromosome-38428396901263unknownWP_000119405
ATGAGTTATGCAGTTTGTAGAATGCAAAAAGTGAAATCAGCTGGACTAAAAGGCATGCAATTTCATAATCAAAGAGAGCGAAAAAGTAGAACGAATGATGATATTGACCATGAGCGAACACGTGAAAATTATGATTTGAAAAATGATAAAAATATTGATTACAACGAACGTGTCAAAGAAATTATTGAATCACAAAAAACAGGTACAAGAAAAACGAGGAAAGATGCTGTTCTTGTAAATGAGTTGCTAGTAACATCTGACCGAGATTTTTTTGAGCAACTGGATCCAGGAGAACAAAAACGATTTTTTGAGGAAAGTTATAAATTATTTTCCGAACGATATGGCAAGCAAAATATTGCTTATGCAACAGTTCATAATGATGAGCAAACCCCTCACATGCATTTAGGTGTTGTGCCTATGCGTGATGGAAAACTGCAAGGAAAAAATGTGTTTAATCGTCAAGAACTGTTATGGCTACAAGATAAATTCCCCGAGCATATGAAAAAACAGGGTTTTGAGTTGAAGCGTGGTGAACGTGGCTCTGACCGTAAACATATTGAGACAGCTAAATTTAAAAAACAAACTTTGGAAAAAGAGATTGATTTTCTAGAAAAAAATTTAGCAGTTAAAAAAGATGAATGGACTGCTTATAGCGATAAAGTTAAATCAGATTTAGAAGTACCAGCGAAACGACACATGAAAAGTGTTGAAGTGCCAACGGGTGAAAAGTCTATGTTTGGTTTGGGAAAAGAAATAATGAAAACAGAAAAGAAACCAACCAAAAATGTTGTTATATCGGAGCGTGATTATAAAAACTTAGTGACTGCTGCGAGAGATAACGATAGGTTAAAACAGCATGTTAGAAATCTCATGAGTACTGATATGGCGAGAGAATATAAAAAATTAAGTAAAGAACATGGGCAAGTTAAAGAAAAATATAGTGGTCTTGTAGAGCGATTTAATGAAAATGTAAATGATTATAATGAGTTGCTTGAAGAAAACAAGTCTTTAAAGTCTAAAATAAGCGATTTAAAGCGTGATGTGAGTTTAATCTATGAAAGCACTAAGGAATTCCTTAAGGAACGTACAGACGGCTTAAAAGCCTTTAAAAACGTTTTTAAGGGGTTTGTAGACAAGGTAAAGGATAAAACAGCACAATTCCAAGAAAAACACGATTTAGAACCTAAAAAGAACGAATTTGAACTAACTCATAACCGAGAGGTAAAAAAAGAACGAAGTCGAGATCAGGGAATGAGTTTATAA
Plasmid recombination enzyme type 24209.9710249660-1.17738Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsintegrating conjugative element protein, PFL_4705 familyTIGR037525.8PF01076Mob_PrePlasmid recombination enzymeCL0169Rep246.5no significant predictionno predicted signal peptide0446041550WP_000119405
MSYAVCRMQKVKSAGLKGMQFHNQRERKSRTNDDIDHERTRENYDLKNDKNIDYNERVKEIIESQKTGTRKTRKDAVLVNELLVTSDRDFFEQLDPGEQKRFFEESYKLFSERYGKQNIAYATVHNDEQTPHMHLGVVPMRDGKLQGKNVFNRQELLWLQDKFPEHMKKQGFELKRGERGSDRKHIETAKFKKQTLEKEIDFLEKNLAVKKDEWTAYSDKVKSDLEVPAKRHMKSVEVPTGEKSMFGLGKEIMKTEKKPTKNVVISERDYKNLVTAARDNDRLKQHVRNLMSTDMAREYKKLSKEHGQVKEKYSGLVERFNENVNDYNELLEENKSLKSKISDLKRDVSLIYESTKEFLKERTDGLKAFKNVFKGFVDKVKDKTAQFQEKHDLEPKKNEFELTHNREVKKERSRDQGMSL
no data available
SA_RS00305SA0032S. aureus N315SAUPAN000091000bleCDSSA_RS00305bleomycin binding proteinchromosome-4019740601405unknownWP_001242578
GTGAGAATGTTACAGTCTATCCCGGCATTGCCAGTCGGGGATATTAAAAAGAGTATAGGTTTTTATTGCGATAAACTAGGTTTCACTTTGGTTCACCATGAAGATGGATTCGCAGTTCTAATGTGTAATGAGGTTCGGATTCATCTATGGGAGGCAAGTGATGAAGGCTGGCGCTCTCGTAGTAATGATTCACCGGTTTGTACAGGTGCGGAGTCGTTTATTGCTGGTACTGCTAGTTGCCGCATTGAAGTAGAGGGAATTGATGAATTATATCAACATATTAAGCCTTTGGGCATTTTGCACCCCAATACATCATTAAAAGATCAGTGGTGGGATGAACGAGACTTTGCAGTAATTGATCCCGACAACAATTTGATTAGCTTTTTTCAACAAATAAAAAGCTAA
bleomycin binding protein1344.7476515209.2-0.218657MetabolismEnergy metabolism; Central intermediary metabolismOther; Amino sugarslactoylglutathione lyaseTIGR0006816.9PF00903GlyoxalaseGlyoxalase/Bleomycin resistance protein/Dioxygenase superfamilyCL0104Glyoxalase38.1Cytoplasmicno predicted signal peptide0447165322WP_001242578
MRMLQSIPALPVGDIKKSIGFYCDKLGFTLVHHEDGFAVLMCNEVRIHLWEASDEGWRSRSNDSPVCTGAESFIAGTASCRIEVEGIDELYQHIKPLGILHPNTSLKDQWWDERDFAVIDPDNNLISFFQQIKS
no data available
SA_RS00310SA0033S. aureus N315SAUPAN000092000aadDCDSSA_RS00310aminoglycoside O-nucleotidyltransferase ANT(4')-Iachromosome-4081841588771unknownWP_001795128
ATGAGAATAGTGAATGGACCAATAATAATGACTAGAGAAGAAAGAATGAAGATTGTTCATGAAATTAAGGAACGAATATTGGATAAATATGGGGATGATGTTAAGGCTATTGGTGTTTATGGCTCTCTTGGTCGTCAGACTGATGGGCCCTATTCGGATATTGAGATGATGTGTGTCATGTCAACAGAGGAAGCAGAGTTCAGCCATGAATGGACAACCGGTGAGTGGAAGGTGGAAGTGAATTTTGATAGCGAAGAGATTCTACTAGATTATGCATCTCAGGTGGAATCAGATTGGCCGCTTACACATGGTCAATTTTTCTCTATTTTGCCGATTTATGATTCAGGTGGATACTTAGAGAAAGTGTATCAAACTGCTAAATCGGTAGAAGCCCAAACGTTCCACGATGCGATTTGTGCCCTTATCGTAGAAGAGCTGTTTGAATATGCAGGCAAATGGCGTAATATTCGTGTGCAAGGACCGACAACATTTCTACCATCCTTGACTGTACAGGTAGCAATGGCAGGTGCCATGTTGATTGGTCTGCATCATCGCATCTGTTATACGACGAGCGCTTCGGTCTTAACTGAAGCAGTTAAGCAATCAGATCTTCCTTCAGGTTATGACCATCTGTGCCAGTTCGTAATGTCTGGTCAACTTTCCGACTCTGAGAAACTTCTGGAATCGCTAGAGAATTTCTGGAATGGGATTCAGGAGTGGACAGAACGACACGGATATATAGTGGATGTGTCAAAACGCATACCATTTTGA
aminoglycoside O-nucleotidyltransferase ANT(4')-Ia2564.4977629165.9-0.204688PF07827KNTase_CKNTase C-terminal domainCL0291KNTase_C121.8
SA_RS00335; SA_RS01275; SA_RS01365; SA_RS02415; SA_RS02905; SA_RS02920; SA_RS02955; SA_RS02960; SA_RS04575; SA_RS05350; SA_RS06225; SA_RS07205; SA_RS07920; SA_RS08545; SA_RS08560; SA_RS08600; SA_RS08625; SA_RS09855; SA_RS11060; SA_RS11130; SA_RS11430; SA_RS11600; SA_RS11680; SA_RS11705; SA_RS11720; SA_RS11735; SA_RS11760; SA_RS11770; SA_RS13915
Cytoplasmicno predicted signal peptide0487710896WP_001795128
MRIVNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHGQFFSILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLPSLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF
no data available 21166474
SA_RS00315SA0034S. aureus N315SAUPAN000080000tnpCDSSA_RS00315IS6 family transposase IS431mecchromosome-4178142455675unknownWP_001106057
ATGAACTATTTCAGATATAAACAATTTAACAAGGATGTTATCACTGTAGCCGTTGGCTACTATCTAAGATATACATTGAGTTATCGTGATATATCTGAAATATTAAGGGAACGTGGTGTAAACGTTCATCATTCAACGGTCTACCGTTGGGTTCAAGAATATGCCCCAATTTTGTATCAAATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATCAAAATAAAAGGAAAATGGAGCTATTTATATCGTGCCATTGATGCAGAGGGACATACATTAGATATTTGGTTGCGTAAGCAACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTCATTAAACAATTTGGTAAACCTCAAAAGGTAATTACAGATCAGGCACCTTCAACGAAGGTAGCAATGGCTAAAGTAATTAAAGCTTTTAAACTTAAACCTGACTGTCATTGTACATCGAAATATCTGAATAACCTCATTGAGCAAGATCACCGTCATATTAAAGTAAGAAAGACAAGGTATCAAAGTATCAATACAGCAAAGAATACTTTAAAAGGTATTGAATGTATTTACGCTCTATATAAAAAGAACCGCAGGTCTCTTCAGATCTACGGATTTTCGCCATGCCACGAAATTAGCATCATGCTAGCAAGTTAA
IS6 family transposase IS431mec22410.42726915.2-0.601339PF13610DDE_Tnp_IS240DDE domainCL0219RNase_H133.2Cytoplasmicno predicted signal peptide0447028801WP_001106057
MNYFRYKQFNKDVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS
no data available
SA_RS14390S. aureus N315CDSSA_RS14390thiolase-like proteinchromosome+4249142880390unknownWP_020444595
ATTCAACTTTGCAACAGAACCGTATTATGGAATAGAGATGTTGGTAACATTTATACAGGATCATTATACTTAAGTTTAATTTCGTTATTACAGAACCACACATTCCAACCAGAAGAGAAAGTATGTCTATTTAGTTATGGTTCAGGAGCAGTAGGAGAAATCTTTAGTGGTTCAATCGTTAAAGGATATGACAAAGCATTAGATAAAGAGAAACACTTAAATATGCTAGAATCTAGAGAGCAATTATCAGTCGAAGAATACGAAACATTCTTTAACAGATTTGATAATCAAGAATTTGATTTCGAACGTGAATTGACACAAGATCCATATTCAAAAGTATACTTATACAGTATAGAAGACCATATCAGAACATATAAGATAGAGAAATAA
thiolase-like protein1294.6725215244-0.53876hydroxymethylglutaryl-CoA synthaseTIGR01835115.5PF08540HMG_CoA_synt_CHydroxymethylglutaryl-coenzyme A synthase C terminalCL0046Thiolase50Cytoplasmicno predicted signal peptide0WP_020444595
MQLCNRTVLWNRDVGNIYTGSLYLSLISLLQNHTFQPEEKVCLFSYGSGAVGEIFSGSIVKGYDKALDKEKHLNMLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK
no data available
SA_RS14395S. aureus N315CDSSA_RS14395hypothetical proteinchromosome+4297843208231unknownWP_001797648
ATGCTTATTTTTTTATCTTACGATTTTGTACGTGCATGCTTGCCTAGGGGTATGGCTCGAGCCATTAGTCTCTCGCACATACTATTCCCTCAGGCGTCAGCACTTACAAAATCGGTTGTAATTTTCATTTTTATACGCATTCTTACTGAGATTATACTAATAAGAGGAATAGTAAAAGCAATTCTAAGTAAAATTGCAGATAAGAGGTTTGTTAAAAGCAGTTCTAAGTAA
hypothetical protein7611.65958537.420.893421Cytoplasmic Membraneno predicted signal peptide1WP_001797648
MLIFLSYDFVRACLPRGMARAISLSHILFPQASALTKSVVIFIFIRILTEIILIRGIVKAILSKIADKRFVKSSSK
no data available
SA_RS00325SA0036S. aureus N315SAUPAN000099000ugpQCDSSA_RS00325glycerophosphoryl diester phosphodiesterasechromosome+4371744460744unknownWP_000958858
ATGCTAACTGTATATGGACATAGAGGATTACCTAGTAAAGCTCCGGAAAATACAATTGCATCATTTAAAGCTGCTTCAGAAGTAGAAGGTATAAACTGGTTGGAGTTAGATGTTGCAATTACAAAAGATGAACAACTGATTATCATTCATGATGATTATTTAGAACGGACTACAAATATGTCCGGGGAAATAACTGAATTGAATTATGATGAAATTAAAGATGCTTCTGCAGGATCTTGGTTTGGTGAAAAATTCAAAGATGAACATTTGCCAACTTTCGATGATGTAGTAAAAATAGCAAATGAATATAATATGAATTTAAATGTAGAATTAAAAGGTATTACTGGACCGAATGGACTAGCACTTTCTAAAAGTATGGTTAAGCAAGTGGAAGAACAATTAACAAACTTAAATCAGAATCAAGAAGTGCTCATTTCAAGCTTTAATGTTGTGCTTGTTAAACTTGCAGAAGAAATCATGCCACAATATAACAGAGCAGTTATATTCCATACAACTTCGTTTCGTGAAGACTGGAGAACACTTTTAGATTACTGTAATGCTAAAATAGTAAACACTGAAGATGCCAAACTTACTAAAGCAAAAGTAAAAATGGTAAAAGAAGCGGGTTATGAATTGAACGTATGGACTGTAAACAAACCAGCACGTGCAAACCAACTTGCTAATTGGGGAGTTGATGGTATCTTTACAGACAATGCAGATAAAATGGTGCATTTGTCTCAATAG
glycerophosphoryl diester phosphodiesterase2474.6584827899.4-0.346559MetabolismEnergy metabolismMethanogenesistetrahydromethanopterin S-methyltransferase, subunit BTIGR0416612.4PF03009GDPDGlycerophosphoryl diester phosphodiesterase familyCL0384PLC151.9Cytoplasmicno predicted signal peptide0446881602WP_000958858
MLTVYGHRGLPSKAPENTIASFKAASEVEGINWLELDVAITKDEQLIIIHDDYLERTTNMSGEITELNYDEIKDASAGSWFGEKFKDEHLPTFDDVVKIANEYNMNLNVELKGITGPNGLALSKSMVKQVEEQLTNLNQNQEVLISSFNVVLVKLAEEIMPQYNRAVIFHTTSFREDWRTLLDYCNAKIVNTEDAKLTKAKVKMVKEAGYELNVWTVNKPARANQLANWGVDGIFTDNADKMVHLSQ
no data available
SA_RS00330SA0037S. aureus N315SAUPAN000100000maoCCDSSA_RS00330hypothetical proteinchromosome+4455744985429unknownWP_000872606
ATGAAATACGATGATTTTATAGTAGGAGAAACATTCAAAACAAAAAGCCTTCATATTACAGAAGAAGAAATTATCCAATTTGCAACAACTTTTGATCCTCAATATATGCATATAGATAAAGAAAAAGCAGAACAAAGTAGATTTAAAGGTATCATTGCATCTGGCATGCATACACTTTCAATATCATTTAAATTATGGGTAGAAGAAGGTAAATACGGAGAAGAAGTTGTAGCAGGAACACAAATGAATAACGTTAAATTTATTAAACCTGTATACCCAGGTAATACATTGTACGTTATCGCTGAAATTACAAATAAGAAATCCATAAAAAAAGAAAATGGACTCGTTACAGTGTCACTTTCAACATACAATGAAAATGAAGAAATTGTATTTAAGGGAGAAGTAACAGCACTTATTAATAATTCATAA
hypothetical protein1425.280316136.3-0.311268phenylacetic acid degradation protein paaNTIGR0227860.4PF01575MaoC_dehydratasMaoC like domainCL0050HotDog112.9no significant predictionno predicted signal peptide0446795350WP_000872606
MKYDDFIVGETFKTKSLHITEEEIIQFATTFDPQYMHIDKEKAEQSRFKGIIASGMHTLSISFKLWVEEGKYGEEVVAGTQMNNVKFIKPVYPGNTLYVIAEITNKKSIKKENGLVTVSLSTYNENEEIVFKGEVTALINNS
no data available
SA_RS00335SA0038S. aureus N315SAUPAN000101000mecACDSSA_RS00335PBP2a family beta-lactam-resistant peptidoglycan transpeptidase MecAchromosome-45031470402010unknownWP_001801873
TTGATGAAAAAGATAAAAATTGTTCCACTTATTTTAATAGTTGTAGTTGTCGGGTTTGGTATATATTTTTATGCTTCCAAAGATAAAGAAATTAATAATACTATTGATGCAATTGAAGATAAAAATTTCAAACAAGTTTATAAAGATAGCAGTTATATTTCTAAAAGCGATAATGGTGAAGTAGAAATGACTGAACGTCCGATAAAAATATATAATAGTTTAGGCGTTAAAGATATAAACATTCAGGATCGTAAAATAAAAAAAGTATCTAAAAATAAAAAACGAGTAGATGCTCAATATAAAATTAAAACAAACTACGGTAACATTGATCGCAACGTTCAATTTAATTTTGTTAAAGAAGATGGTATGTGGAAGTTAGATTGGGATCATAGCGTCATTATTCCAGGAATGCAGAAAGACCAAAGCATACATATTGAAAATTTAAAATCAGAACGTGGTAAAATTTTAGACCGAAACAATGTGGAATTGGCCAATACAGGAACAGCATATGAGATAGGCATCGTTCCAAAGAATGTATCTAAAAAAGATTATAAAGCAATCGCTAAAGAACTAAGTATTTCTGAAGACTATATCAAACAACAAATGGATCAAAATTGGGTACAAGATGATACCTTCGTTCCACTTAAAACCGTTAAAAAAATGGATGAATATTTAAGTGATTTCGCAAAAAAATTTCATCTTACAACTAATGAAACAGAAAGTCGTAACTATCCTCTAGGAAAAGCGACTTCACATCTATTAGGTTATGTTGGTCCCATTAACTCTGAAGAATTAAAACAAAAAGAATATAAAGGCTATAAAGATGATGCAGTTATTGGTAAAAAGGGACTCGAAAAACTTTACGATAAAAAGCTCCAACATGAAGATGGCTATCGTGTCACAATCGTTGACGATAATAGCAATACAATCGCACATACATTAATAGAGAAAAAGAAAAAAGATGGCAAAGATATTCAACTAACTATTGATGCTAAAGTTCAAAAGAGTATTTATAACAACATGAAAAATGATTATGGCTCAGGTACTGCTATCCACCCTCAAACAGGTGAATTATTAGCACTTGTAAGCACACCTTCATATGACGTCTATCCATTTATGTATGGCATGAGTAACGAAGAATATAATAAATTAACCGAAGATAAAAAAGAACCTCTGCTCAACAAGTTCCAGATTACAACTTCACCAGGTTCAACTCAAAAAATATTAACAGCAATGATTGGGTTAAATAACAAAACATTAGACGATAAAACAAGTTATAAAATCGATGGTAAAGGTTGGCAAAAAGATAAATCTTGGGGTGGTTACAACGTTACAAGATATGAAGTGGTAAATGGTAATATCGACTTAAAACAAGCAATAGAATCATCAGATAACATTTTCTTTGCTAGAGTAGCACTCGAATTAGGCAGTAAGAAATTTGAAAAAGGCATGAAAAAACTAGGTGTTGGTGAAGATATACCAAGTGATTATCCATTTTATAATGCTCAAATTTCAAACAAAAATTTAGATAATGAAATATTATTAGCTGATTCAGGTTACGGACAAGGTGAAATACTGATTAACCCAGTACAGATCCTTTCAATCTATAGCGCATTAGAAAATAATGGCAATATTAACGCACCTCACTTATTAAAAGACACGAAAAACAAAGTTTGGAAGAAAAATATTATTTCCAAAGAAAATATCAATCTATTAACTGATGGTATGCAACAAGTCGTAAATAAAACACATAAAGAAGATATTTATAGATCTTATGCAAACTTAATTGGCAAATCCGGTACTGCAGAACTCAAAATGAAACAAGGAGAAACTGGCAGACAAATTGGGTGGTTTATATCATATGATAAAGATAATCCAAACATGATGATGGCTATTAATGTTAAAGATGTACAAGATAAAGGAATGGCTAGCTACAATGCCAAAATCTCAGGTAAAGTGTATGATGAGCTATATGAGAACGGTAATAAAAAATACGATATAGATGAATAA
PBP2a family beta-lactam-resistant peptidoglycan transpeptidase MecA6699.1923476233.2-0.704335Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanpenicillin-binding protein 2TIGR03423306.2PF00905TranspeptidasePenicillin binding protein transpeptidase domainCL0013Beta-lactamase239.9
SA_RS01710; SA_RS11600
Cytoplasmic Membraneno predicted signal peptide1WP_001801873
MMKKIKIVPLILIVVVVGFGIYFYASKDKEINNTIDAIEDKNFKQVYKDSSYISKSDNGEVEMTERPIKIYNSLGVKDINIQDRKIKKVSKNKKRVDAQYKIKTNYGNIDRNVQFNFVKEDGMWKLDWDHSVIIPGMQKDQSIHIENLKSERGKILDRNNVELANTGTAYEIGIVPKNVSKKDYKAIAKELSISEDYIKQQMDQNWVQDDTFVPLKTVKKMDEYLSDFAKKFHLTTNETESRNYPLGKATSHLLGYVGPINSEELKQKEYKGYKDDAVIGKKGLEKLYDKKLQHEDGYRVTIVDDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNMKNDYGSGTAIHPQTGELLALVSTPSYDVYPFMYGMSNEEYNKLTEDKKEPLLNKFQITTSPGSTQKILTAMIGLNNKTLDDKTSYKIDGKGWQKDKSWGGYNVTRYEVVNGNIDLKQAIESSDNIFFARVALELGSKKFEKGMKKLGVGEDIPSDYPFYNAQISNKNLDNEILLADSGYGQGEILINPVQILSIYSALENNGNINAPHLLKDTKNKVWKKNIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAELKMKQGETGRQIGWFISYDKDNPNMMMAINVKDVQDKGMASYNAKISGKVYDELYENGNKKYDIDE
no data available 21166474
SA_RS00340SA0039S. aureus N315SAUPAN000102000mecR1CDSSA_RS00340beta-lactam sensor/signal transducer MecR1chromosome+47137488941758unknownWP_000952923
GTGTTATCATCTTTTTTAATGTTAAGTATAATCAGTTCATTGCTCACGATATGTGTAATTTTTTTAGTGAGAATGCTCTATATAAAATATACTCAAAATATTATGTCACATAAGATTTGGTTATTAGTGCTCGTCTCCACGTTAATTCCATTAATACCATTTTACAAAATATCGAATTTTACATTTTCAAAAGATATGATGAATCGAAATGTATCTGACACGACTTCTTCGGTTAGTCATATGTTAGATGGTCAACAATCATCTGTTACGAAAGACTTAGCAATTAATGTTAATCAGTTTGAGACCTCAAATATAACGTATATGATTCTTTTGATATGGGTATTTGGTAGTTTGTTGTGCTTATTTTATATGATTAAGGCATTCCGACAAATTGATGTTATTAAAAGTTCGTCATTGGAATCGTCATATCTTAATGAACGACTTAAAGTATGTCAAAGTAAGATGCAGTTCTACAAAAAGCATATAACAATTAGTTATAGTTCAAACATTGATAATCCGATGGTATTTGGTTTAGTGAAATCCCAAATTGTACTACCAACTGTCGTAGTCGAAACCATGAATGACAAAGAAATTGAATATATTATTCTACATGAACTATCACATGTGAAAAGTCATGACTTAATATTCAACCAGCTTTATGTTGTTTTTAAAATGATATTCTGGTTTAATCCTGCACTATATATAAGTAAAACAATGATGGACAATGACTGTGAAAAAGTATGTGATAGAAACGTTTTAAAAATTTTGAATCGCCATGAACATATACGTTATGGTGAATCGATATTAAAATGCTCTATTTTAAAATCTCAGCACATAAATAATGTGGCAGCACAATATTTACTAGGTTTTAATTCAAATATTAAAGAACGTGTTAAGTATATTGCACTTTATGATTCAATGCCTAAACCTAATCGAAACAAGCGTATTGTTGCGTATATTGTATGTAGTATATCGCTTTTAATACAAGCACCGTTACTATCTGCACATGTTCAACAAGACAAATATGAAACAAATGTATCATATAAAAAATTAAATCAACTAGCTCCGTATTTCAAAGGATTTGATGGAAGTTTTGTGCTTTATAATGAACGGGAGCAAGCTTATTCTATTTATAATGAACCAGAAAGTAAACAACGATATTCACCTAATTCTACTTACAAAATTTATTTAGCGTTAATGGCATTCGACCAAAATTTACTCTCATTAAATCATACTGAACAACAATGGGATAAACATCAATATCCATTTAAAGAATGGAACCAAGATCAAAATTTAAATTCTTCAATGAAATATTCAGTAAATTGGTATTACGAAAATTTAAACAAACATTTAAGACAAGATGAGGTTAAATCTTATTTAGATCTAATTGAATATGGTAATGAAGAAATATCAGGGAATGAAAATTATTGGAATGAATCTTCATTAAAAATTTCTGCAATAGAACAGGTTAATTTGTTGAAAAATATGAAACAACATAACATGCATTTTGATAATAAGGCTATTGAAAAAGTTGAAAATAGTATGACTTTGAAACAAAAAGATACTTATAAATATGTAGGTAAAACTGGAACAGGAATCGTGAATCACAAAGAAGCAAATGGATGGTTCGTAGGTTATGTTGAAACGAAAGATAATACGTATTATTTTGCTACACATTTAAAAGGCGAAGACAATGCGAATGGCGAAAAAGCACAACAAATTTCTGAGCGTATTTTAAAAGAAATGGAGTTAATATAA
beta-lactam sensor/signal transducer MecR15858.5098768502.5-0.275043Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanpenicillin-binding protein 2TIGR0342323.9PF05569Peptidase_M56BlaR1 peptidase M56CL0126Peptidase_MA335.8Cytoplasmic Membraneno predicted signal peptide4446875667WP_000952923
MLSSFLMLSIISSLLTICVIFLVRMLYIKYTQNIMSHKIWLLVLVSTLIPLIPFYKISNFTFSKDMMNRNVSDTTSSVSHMLDGQQSSVTKDLAINVNQFETSNITYMILLIWVFGSLLCLFYMIKAFRQIDVIKSSSLESSYLNERLKVCQSKMQFYKKHITISYSSNIDNPMVFGLVKSQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMMDNDCEKVCDRNVLKILNRHEHIRYGESILKCSILKSQHINNVAAQYLLGFNSNIKERVKYIALYDSMPKPNRNKRIVAYIVCSISLLIQAPLLSAHVQQDKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEANGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI
no data available
SA_RS00345SA0040S. aureus N315SAUPAN000104000mecICDSSA_RS00345mecA-type methicillin resistance repressor MecIchromosome+4889449265372unknownWP_000369214
ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGGATGAAAAAATATGCAAGTGCGAATAATATAATAGAAGAAATACAAATGCAAAAGGACTGGAGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATAAAAAGGGATTTATAGATCGTAAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATATAAAACATCTAAAAACTTTATCAATAAAGTATACAAAGGCGGTTTCAATTCACTTGTCTTAAACTTTGTAGAAAAAGAAGATCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTGAATAAAAAATAA
mecA-type methicillin resistance repressor MecI1239.4658914789.9-0.74065Metabolism; Signal transductionTransport and binding proteins; Regulatory functionsCations and iron carrying compounds; DNA interactionscopper transport repressor, CopY/TcrY familyTIGR02698102.1PF03965Penicillinase_RPenicillinase repressorCL0123HTH130.6no significant predictionno predicted signal peptide0446291359WP_000369214
MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
no data available
SA_RS14400S. aureus N315CDS, pseudogeneSA_RS14400hypothetical proteinchromosome-4921849418201unknown
ATGGATTTCACTGGTGTTATTACAAGCATTATTGATTTAATCAAGACTTGCATTCAGGCTTTCGGTTAATTTTTTCAACTAAAAAACAGAGGAAATATTCAACGACTTGATTGTTTCCTCTGTTTTCTATGTATTGTTGTAAACACAACAATTTTATTTTTTATTCAATATATTTCTCAATTCTTCTATTTCATCTTGTGA
hypothetical protein0no predicted signal peptideno data available
SA_RS14405S. aureus N315CDSSA_RS14405hypothetical proteinchromosome+4936649578213unknownWP_001792161
ATGCAAGTCTTGATTAAATCAATAATGCTTGTAATAACACCAGTGAAATCCATATGCATACCCTCTTTCTATTTAAGATACATTAAGTATAATATCAAACAAATAAAAAATGTTAAAAATTCCCTAATTGGCTATTTAGATTGCATAAATGTCAAAAATTTGAAAAACATACAACGACTTTGCATAAAAAATCGTCATATTGGAAATACGTAA
hypothetical protein7010.67028178.950.18no significant predictionno predicted signal peptide0WP_001792161
MQVLIKSIMLVITPVKSICIPSFYLRYIKYNIKQIKNVKNSLIGYLDCINVKNLKNIQRLCIKNRHIGNT
no data available
SA_RS00350SA0041S. aureus N315SAUPAN000106000xylRCDSSA_RS00350hypothetical proteinchromosome+49773508821110unknownWP_000943131
GTGCTAAGGGAAATTTATAACCATCATAATATTTCGCGTACTCAAATATCTAAAAATCTTGAGATTAATAAGGCAACGATTTCTAGTATTTTGAATAAGTTAAAGTATAAATCTCTTGTTAATGAGGTTGGTGAGGGTGATAGCACGAAGAGTGGTGGTAGAAAACCTATTCTTCTGAAGGTTAATCATCTTTATGGTTATTTTATTTCTTTGGATTTAACTTATAGTTCTGTTGAAGTGATGTACAATTATTTTGATGGTAATGTCATTAAGCATGAATCTTATGATTTACCTGATGAAAAGGTTAGTAGTATATTAAGCATAATAAAAAAACATATTGATATTCAGGAGAAACTTGATACTTATAACGGACTATTAGGTGTGTCTGTTTCTATACATGGAGTTGTGGATAATGAGCAGCATGTGACATATTTACCATTCCATGAAACTGAAGGAATTTCAATTGCTAAGAAAATAAAAGAAATTACTAATGTTCCAGTCGTAGTTGAAAATGAAGCGAATCTTTCAGCGTTATATGAACGTAATTTTAATCATAATTTATCCTACAATAATCTTATTGCTTTAAGTATACATAAAGGTATTGGTGCTGGGCTTATTATTAATAATCAATTGTATCGTGGTGCAAATGGGGAAGCGGGTGAAATTGGAAAAACACTTGTCTCAAAAGTTAGCGATAATGTGGAGATCTTTCATAAGATTGAAGATATTTTTTCACAAGAAGCTTTACTGCATAATTTAAGTAATCAACTAAATGAGAAGATGACGCTTAGCAAATTAATTCAATTTTATAATGAAAAAAATCCAGTCGTAGTTGAAGAAATGGAACAATTTATAAATAAAATTGCTGTTTTAATACATAATTTAAACACCCAGTTTAATCCGAATGCAATTTACATTAACTGTCCATTGTTCAATGAAATGCCTGAAATATTAGAAGCAATTAAGAACCAGTTCAAACAATATTCACGTAACGAAATTCAAATAAAGTTAACATCTAATGTCAAATTTGCAACTTTGCTAGGTGGTACATTAGCAATTATCCAAAAAGTACTACAGATTAATGATATTTACTTAGATATAAAAGCATAA
hypothetical protein3696.7114541815.6-0.177236Unknown functionGeneralROK family protein (putative glucokinase)TIGR0074476.4PF00480ROKROK familyCL0108Actin_ATPase117.5Cytoplasmicno predicted signal peptide0446865875WP_000943131
MLREIYNHHNISRTQISKNLEINKATISSILNKLKYKSLVNEVGEGDSTKSGGRKPILLKVNHLYGYFISLDLTYSSVEVMYNYFDGNVIKHESYDLPDEKVSSILSIIKKHIDIQEKLDTYNGLLGVSVSIHGVVDNEQHVTYLPFHETEGISIAKKIKEITNVPVVVENEANLSALYERNFNHNLSYNNLIALSIHKGIGAGLIINNQLYRGANGEAGEIGKTLVSKVSDNVEIFHKIEDIFSQEALLHNLSNQLNEKMTLSKLIQFYNEKNPVVVEEMEQFINKIAVLIHNLNTQFNPNAIYINCPLFNEMPEILEAIKNQFKQYSRNEIQIKLTSNVKFATLLGGTLAIIQKVLQINDIYLDIKA
no data available
SA_RS00360SA0043S. aureus N315SAUPAN000109000-CDS, pseudogeneSA_RS00360MBL fold metallo-hydrolasechromosome-50996523301335unknown
TTGTTTTTCAAACAATTTTATGAAGACAATTTTTCACAAGCATCTTATTTAATTGGATGTCAACGTACAGGAGAAGCAATGATTATTGACCCTATACGAGATTTAACAAAATATTTAAAAGTTGCAGATAAAGAAGGATTCACAATTACTAAAGCTGCAGAAACACATATTCATGCTGATTTTGCTTCAGGTATTAGAGATGTGGCAAATAAATTGAATGCAAGTATATACGTATCTGATGAAGGTAAAGATGAATTTAATTATAAAAATATGCCTAAACAAACACATTTCGTTAAGCATCAAGATATTATCTATTTAGGAAAGATTAAATTAGAAGTCTTACACACTCCAGGCCATCCCCCTGAGAGTATTAGTTTTTTACTTACTGACGAAGGTGGGGGTTCCAGTATACCAATGGGATTATTTAGCGGTGACTTCATCTTTGTTGGTGATGTAGGTAGACCAGATCTATTAGAAAAAGCTGTAAATGTTGAAGGTTCTACAAAAATCGGAGCAAAACAAATGTATCAGTCCATACAATTTGCTGCAACATTACCAGACTATATTCAAATTTGGCCAGGTCATGGTGCAGGGAGTCCTTGTGGTAAAGCGCTAGGTTCATTACCTACAACTACTTTGGGTTATGAGAAAATAAACAACTGGGCTTTTAATGTTAAAGATGAAACTTCATTTATCGAAACTTTAACACTCAATCAGCCAGCTCCACCACACCATTTTTCACAAATGAAAAAAATAAATCAATTTGGTATGCAAATGTACCAACCATATAATGTTTACCCTAGTTCAAGCAATACACAAACTGCTTTTGATCTTCGAAGTAAAGAAGCATTCCATGGTGGTCATATGCATGGAACTATCAATATTCCTTTTAATAAAACTTTTATAAATCAAATTGGTTGGTATTTAGATTATGACTAAGATATTGAATTAATTGGCGATAAATCTACCGTTCAACAAGCTATTCATGCTTTACAATTAATTGGTTTTGAAAATGTAAAAAGTTACCGTTTGCCACAAACAAATATCGTCACATCATCTATTCATAGTTCTGAAATGACTGGTGAAGAACATAATGTATTAGATGTTCGTAATGATGATGAATGGCGTAAAGGTCATTTAAAACAAGCAATTCATATTCCTCACGGTAAACTTTTAAATGAAGATATACCTTTCGATAAAAATGACCTAATTTATGTACATTGTCAATCAGGTGTTAGAAGTTCAATAGCGGTAGGAATATTAGAATATAAAGGATTTACGAATATTGTTAACGTTAGAGGTGGCTATCAACATTTACCAGCATTTTTAAAATAG
MBL fold metallo-hydrolase0no predicted signal peptideno data available
SA_RS00365SA0044S. aureus N315SAUPAN000110000-CDSSA_RS00365dihydroneopterin aldolasechromosome-52363534271065unknownWP_000438836
ATGGAACAATACAAAGAAGTACACATTAATTCATTAAACAAAGAAGAATTAGAAAAATTGGCAAAAATGGGTCAATTGATTGATGTTAGAACAAAAGAAGAATATGAATTAGGACACATTAACGGTTCAACTTTACACCCAGTAGAAGAGATTAAATCATTCAATAAGAATAGCAACAAAACGTATTATATACATTGTAAAAGCGGTAACCGAAGCACTAAAGCTTGCGATTATTTAGCCAAACAAGGTTATGATGTCGTGAATTTAAAGGGTGGATATAAAGATTATGAAGCAAAGAACTTCAATAGTGCTCCTTTAATAGAAAAAGATATTGAAATCAAAGAGAATCGTAAACAATTTGATTTTAGAGGTCTTCAGTGCCCTGGACCTATTGTTAATATCAGTAAAGAAATTAACAATATTTCAACGGGTGAGCAAATCGAGGTAACAGTTACAGATCCTGGTTTCAATAGTGATATTAAAAGTTGGGCGAAACAAACAGGGAATACCCTTGTAAATCTTACTGAAGAAGCAAATGTAATTAATGCAATTATTCAAAAAGAAAAGCCAAAAGAATTTGAAATCAATGACACTGCTACAGGTACAACAATTGTTTTATTTAGCGGTGAGTTAGATAAGGCAGTAGCAGCAATGATCATCGCAAATGGCGCTAAAGCAGCAGGTAAAGATGTAACTATTTTCTTTACTTTTTGGGGCCTCAACGCATTAAAAAAAGCGCAATCAACTCGCGTTAAAAAGAAAGGTATTTCCAAAATGTTTGACCTTATGTTACCTAAGGATCCAATACATATGCCATTATCAAAAATGAATATGTTTGGACTAGGTAATATTATGATGCGTTATGTAATGAACAAGAAAAATGTTGATTCTTTATACTCACTTATCGATCAAGCAATCGATCAAGATATAAAGTTAATTGCTTGTACCATGAGTATGGATGTTATGGGAATTTCAAAAGAAGAATTAAGAGATGAAGTCGATTATGGTGGCGTAGGTACTTATATTGGACATACTGAGCAAGCAAATCATAACTTATTTATCTAA
dihydroneopterin aldolase3546.8803639758.3-0.418079phage shock operon rhodanese PspETIGR0298132.8PF13686DrsE_2DsrE/DsrF/DrsH-like familyCL0394DsrEFH-like187.4Cytoplasmicno predicted signal peptide0446360981WP_000438836
MEQYKEVHINSLNKEELEKLAKMGQLIDVRTKEEYELGHINGSTLHPVEEIKSFNKNSNKTYYIHCKSGNRSTKACDYLAKQGYDVVNLKGGYKDYEAKNFNSAPLIEKDIEIKENRKQFDFRGLQCPGPIVNISKEINNISTGEQIEVTVTDPGFNSDIKSWAKQTGNTLVNLTEEANVINAIIQKEKPKEFEINDTATGTTIVLFSGELDKAVAAMIIANGAKAAGKDVTIFFTFWGLNALKKAQSTRVKKKGISKMFDLMLPKDPIHMPLSKMNMFGLGNIMMRYVMNKKNVDSLYSLIDQAIDQDIKLIACTMSMDVMGISKEELRDEVDYGGVGTYIGHTEQANHNLFI
no data available
SA_RS00370SA0045S. aureus N315SAUPAN000111000-CDSSA_RS00370hypothetical proteinchromosome+5356353823261unknownWP_000220507
ATGACTTATGATAAAAAAATGATTAATCGTATAAATAGAATACAAGGTCAATTAAATGGTGTCGTAAAAATGATGGAAGAAGAAAAAGATTGCAAAGATATAATTACGCAACTTAGTGCATCTAAAGGTTCTATACAACGTTTAATGGGGATTATAATTAGTGAAAATTTAATAGAATGCGTTAAAACAGCAGAAGAAAATAATGAAAGTTCTCAAGAATTAATTAATGAAGCAGTTAATTTATTAGTTAAAAGTAAATAA
hypothetical protein865.151919742.27-0.386046PF02583Trns_repr_metalMetal-sensitive transcriptional repressorno clan definedno clan defined83.9no significant predictionno predicted signal peptide0446142652WP_000220507
MTYDKKMINRINRIQGQLNGVVKMMEEEKDCKDIITQLSASKGSIQRLMGIIISENLIECVKTAEENNESSQELINEAVNLLVKSK
no data available
SA_RS00375SA0046S. aureus N315SAUPAN000112000-CDSSA_RS00375anion permeasechromosome+5382354467645unknownWP_000350222
ATGGATATAGCAAATATGACTATTATGTTGCTAATTGGCGTACTGGGTGGATTTATATCTGGATTAATAGGTATTGGGGGCGCAATTATTATTTACCCAGCTATTCTTATATTGCCACCATTAATAGGTATACCTGCGTATAGTGCATATATTGCTTCGGGACTTACCTCTAGTCAAGTATTTTTCAGTACACTTAGTGGATCATTAAATGCAAGAAAACAACCAGCTTTCTCTCCTAAACTTGTTATATATATGGGAGGGGGTATGTTGATTGGAAGCATGTTAGGGGCAATTTTAGCTAGTTTGTTTAATGCTACTTTTGTAAATACGGTATATGTAATAATCGCCATACTTGCTTTAATATTGATGTTTATTAAAGTTAAACCTACTACACAAGAGACGAAATCTAAACCTTTGCTATTTATTATAGTTGGATTTGGAATTGGTGTAATTTCGGGAATTGTGGGTGCAGGTGGAGCATTTATCATCATTCCTGTATTATTAGCATTATTTAAATTACCAATGAATACGGTAGTGAACAATAGCATAGCAATTGCTTTTATATCTTCAGTAGGGGCATTTTTTATAAAATTAATGCAAGGATATATACCAGTAGAAAGTGCAATTTTTTTGATAATTGAATGA
anion permease21410.049222359.11.33084PF01925TauESulfite exporter TauE/SafECL0292LysE110.6Cytoplasmic Membraneno predicted signal peptide6446272367WP_000350222
MDIANMTIMLLIGVLGGFISGLIGIGGAIIIYPAILILPPLIGIPAYSAYIASGLTSSQVFFSTLSGSLNARKQPAFSPKLVIYMGGGMLIGSMLGAILASLFNATFVNTVYVIIAILALILMFIKVKPTTQETKSKPLLFIIVGFGIGVISGIVGAGGAFIIIPVLLALFKLPMNTVVNNSIAIAFISSVGAFFIKLMQGYIPVESAIFLIIE
no data available
locus tagold locus tagnew locus tagorganismpan locus tagpan gene symboltypesymbolsynonymproductcommentrepliconstrandstartendgene lengthessentialGene IDgene RefSeqMicrobesOnlineDNAdescriptionprotein lengththeoretical pItheoretical MWGRAVYECTIGRFAM Meta RoleTIGRFAM Main RoleTIGRFAM Sub RoleTIGRFAM functionTIGRFAMTIGRFAM HMM scoreTheSEEDPFAM AccessionPFAMPFAM descriptionPFAM clan accessionPFAM clanPFAM HMM scoreeffectorinteraction partnersPSORTbLocatePSignalPtransmembrane helicesprotein GIUniProtprotein RefSeqprotein sequenceprotein peptides detectedprotein copies per celloperonregulatorpubmed
SAOUHSC_00001S. aureus NCTC8325SAUPAN000006000dnaACDSdnaAchromosomal replication initiation proteinchromosome+51718781362yes3919798YP_4986091288501
ATGTCGGAAAAAGAAATTTGGGAAAAAGTGCTTGAAATTGCTCAAGAAAAATTATCAGCTGTAAGTTACTCAACTTTCCTAAAAGATACTGAGCTTTACACGATTAAAGATGGTGAAGCTATCGTATTATCGAGTATTCCTTTTAATGCAAATTGGTTAAATCAACAATATGCTGAAATTATCCAAGCAATCTTATTTGATGTTGTAGGCTATGAAGTTAAACCTCACTTTATTACTACTGAAGAATTAGCAAATTATAGTAATAATGAAACTGCTACTCCAAAAGAAACAACAAAACCTTCTACTGAAACAACTGAGGATAATCATGTGCTTGGTAGAGAGCAATTCAATGCCCATAACACATTTGACACTTTTGTAATCGGACCCGGTAACCGCTTTCCACATGCAGCGAGTTTAGCTGTGGCCGAAGCACCAGCCAAAGCGTACAATCCATTATTTATCTATGGAGGTGTTGGTTTAGGAAAAACCCATTTAATGCATGCCATTGGTCATCATGTTTTAGATAATAATCCAGATGCCAAAGTGATTTACACATCAAGTGAAAAATTCACAAATGAATTTATTAAATCAATTCGTGATAACGAAGGTGAAGCTTTCAGAGAAAGATATCGTAATATCGACGTCTTATTAATCGATGATATTCAGTTCATACAAAACAAGGTACAAACACAAGAAGAATTTTTCTATACTTTTAATGAATTGCATCAGAATAACAAGCAAATAGTTATTTCGAGTGATCGACCACCAAAGGAAATTGCACAATTAGAAGACCGATTACGTTCACGCTTTGAATGGGGGCTAATTGTTGATATTACGCCACCAGATTATGAAACTCGAATGGCAATTTTGCAGAAGAAAATTGAAGAAGAAAAATTAGATATTCCACCAGAAGCTTTAAATTATATAGCAAATCAAATTCAATCTAATATTCGTGAATTAGAAGGTGCATTAACACGTTTACTTGCATATTCACAATTATTAGGAAAACCAATTACAACTGAATTAACTGCTGAAGCTTTAAAAGATATCATTCAAGCACCAAAATCTAAAAAGATTACCATCCAAGATATTCAAAAAATTGTAGGCCAGTACTATAATGTTAGAATTGAAGATTTCAGTGCAAAAAAACGTACAAAGTCAATTGCATATCCGCGTCAAATAGCTATGTACTTGTCTAGAGAGCTTACAGATTTCTCATTACCTAAAATTGGTGAAGAATTTGGTGGGCGTGATCATACGACCGTCATTCATGCTCATGAAAAAATATCTAAAGATTTAAAAGAAGATCCTATTTTTAAACAAGAAGTAGAGAATCTTGAAAAAGAAATAAGAAATGTATAA
chromosomal replication initiation protein4535.1162651965.3-0.488742Genetic information processingDNA metabolismDNA replication, recombination, and repairchromosomal replication initiator protein DnaATIGR00362594.7DNA Metabolism / DNA replication / DNA-replication / Chromosomal replication initiator protein DnaA; Cell Division Subsystem including YidCD / Chromosomal replication initiator protein DnaAPF00308Bac_DnaABacterial dnaA proteinCL0023P-loop_NTPase340.4CytoplasmicIntracellularno predicted signal peptide088193824Q2G2H5YP_498609
MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
no data available MicrobesOnline: SAOUHSC_00001 > SAOUHSC_0000219570206; 26224020; 28887440
SAOUHSC_00002S. aureus NCTC8325SAUPAN000007000dnaNCDSSAOUHSC_00002DNA polymerase III subunit betachromosome+215632891134yes3919799YP_4986101288502
ATGATGGAATTCACTATTAAAAGAGATTATTTTATTACACAATTAAATGACACATTAAAAGCTATTTCACCAAGAACAACATTACCTATATTAACTGGTATCAAAATCGATGCGAAAGAACATGAAGTTATATTAACTGGTTCAGACTCTGAAATTTCAATAGAAATCACTATTCCTAAAACTGTAGATGGCGAAGATATTGTCAATATTTCAGAAACAGGCTCAGTAGTACTTCCTGGACGATTCTTTGTTGATATTATAAAAAAATTACCTGGTAAAGATGTTAAATTATCTACAAATGAACAATTCCAGACATTAATTACATCAGGTCATTCTGAATTTAATTTAAGTGGCTTAGATCCAGATCAATATCCTTTATTACCTCAAGTTTCTAGAGATGACGCAATTCAATTGTCGGTAAAAGTGCTTAAAAACGTGATTGCACAAACAAATTTTGCAGTGTCCACCTCAGAAACACGCCCAGTACTAACTGGTGTGAACTGGCTTATACAAGAAAATGAATTAATATGCACAGCGACTGACTCACACCGCTTGGCTGTAAGAAAGTTGCAGTTAGAAGATGTTTCTGAAAACAAAAATGTCATCATTCCAGGTAAGGCTTTAGCTGAATTAAATAAAATTATGTCTGACAATGAAGAAGACATTGATATCTTCTTTGCTTCAAACCAAGTTTTATTTAAAGTTGGAAATGTGAACTTTATTTCTCGATTATTAGAAGGACATTATCCTGATACAACACGTTTATTCCCTGAAAACTATGAAATTAAATTAAGTATAGACAATGGGGAGTTTTATCATGCGATTGATCGTGCCTCTTTATTAGCGCGTGAAGGTGGTAATAACGTTATTAAATTAAGTACAGGTGATGACGTTGTTGAATTGTCTTCTACATCACCAGAAATTGGTACTGTAAAAGAAGAAGTTGATGCAAACGATGTTGAAGGTGGTAGCCTGAAAATTTCATTCAACTCTAAATATATGATGGATGCTTTAAAAGCAATCGATAATGATGAGGTTGAAGTTGAATTCTTCGGTACAATGAAACCATTTATTCTAAAACCAAAAGGTGACGACTCGGTAACGCAATTAATTTTACCAATCAGAACTTACTAA
DNA polymerase III subunit beta3774.4028441913.3-0.1615382.7.7.7Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, beta subunitTIGR00663375.1DNA Metabolism / DNA replication / DNA-replication / DNA polymerase III beta subunit (EC 2.7.7.7); Cell Division Subsystem including YidCD / DNA polymerase III beta subunit (EC 2.7.7.7)PF00712DNA_pol3_betaDNA polymerase III beta subunit, N-terminal domainCL0060DNA_clamp184CytoplasmicIntracellularno predicted signal peptide088193825Q2G2H4YP_498610
MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIRTY
no data available MicrobesOnline: SAOUHSC_00001 > SAOUHSC_0000219570206; 26224020; 28887440
SAOUHSC_00003S. aureus NCTC8325SAUPAN000009000-CDSSAOUHSC_00003hypothetical proteinchromosome+36703915246yes3919176YP_4986111288503
GTGATTATTTTGGTTCAAGAAGTTGTAGTAGAAGGAGACATTAATTTAGGTCAATTTCTAAAAACAGAAGGGATTATTGAATCTGGTGGTCAAGCAAAATGGTTCTTGCAAGACGTTGAAGTATTAATTAATGGAGTGCGTGAAACACGTCGCGGTAAAAAGTTAGAACATCAAGATCGTATAGATATCCCAGAATTACCTGAAGATGCTGGTTCTTTCTTAATCATTCATCAAGGTGAACAATGA
hypothetical protein814.355789137.35-0.197531Genetic information processingDNA metabolismDNA replication, recombination, and repairS4 domain protein YaaATIGR0298890Hypothetical Coupled to RecF / FIG002958: hypothetical proteinPF13275S4_2S4 domainCL0492S474.4
SAOUHSC_00069; SAOUHSC_00100; SAOUHSC_00187; SAOUHSC_00225; SAOUHSC_00336; SAOUHSC_00365; SAOUHSC_00444; SAOUHSC_00493; SAOUHSC_00505; SAOUHSC_00509; SAOUHSC_00517; SAOUHSC_00518; SAOUHSC_00520; SAOUHSC_00524; SAOUHSC_00527; SAOUHSC_00529; SAOUHSC_00530; SAOUHSC_00574; SAOUHSC_00608; SAOUHSC_00655; SAOUHSC_00669; SAOUHSC_00679; SAOUHSC_00690; SAOUHSC_00694; SAOUHSC_00743; SAOUHSC_00795; SAOUHSC_00796; SAOUHSC_00797; SAOUHSC_00798; SAOUHSC_00799; SAOUHSC_00835; SAOUHSC_00895; SAOUHSC_00900; SAOUHSC_00937; SAOUHSC_00951; SAOUHSC_01007; SAOUHSC_01028; SAOUHSC_01036; SAOUHSC_01100; SAOUHSC_01159; SAOUHSC_01199; SAOUHSC_01216; SAOUHSC_01234; SAOUHSC_01287; SAOUHSC_01327; SAOUHSC_01373; SAOUHSC_01403; SAOUHSC_01490; SAOUHSC_01493; SAOUHSC_01605; SAOUHSC_01625; SAOUHSC_01632; SAOUHSC_01653; SAOUHSC_01666; SAOUHSC_01683; SAOUHSC_01737; SAOUHSC_01801; SAOUHSC_01802; SAOUHSC_01820; SAOUHSC_01822; SAOUHSC_01845; SAOUHSC_01868; SAOUHSC_01901; SAOUHSC_01910; SAOUHSC_02102; SAOUHSC_02116; SAOUHSC_02254; SAOUHSC_02318; SAOU
CytoplasmicIntracellularno predicted signal peptide088193826Q2G276YP_498611
MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ
no data available MicrobesOnline: SAOUHSC_00003 > SAOUHSC_00004 > SAOUHSC_00005 > SAOUHSC_0000619570206; 21166474; 26224020; 28887440
SAOUHSC_00004S. aureus NCTC8325SAUPAN000010000recFCDSrecFrecombination protein Fchromosome+391250241113no3919177YP_4986121288504
ATGAAGTTAAATACACTCCAATTAGAAAATTATCGTAACTATGATGAGGTTACGTTGAAATGTCATCCTGACGTGAATATCCTCATTGGAGAAAATGCACAAGGAAAGACAAATTTACTTGAATCAATTTATACCTTAGCTTTAGCAAAAAGTCATAGAACGAGTAATGATAAGGAACTCATACGTTTTAATGCTGATTATGCTAAAATAGAAGGTGAGCTTAGTTATAGACACGGCACGATGCCATTAACAATGTTTATAACTAAAAAAGGTAAACAAGTCAAAGTGAATCACTTAGAGCAAAGTCGTCTAACTCAATATATTGGACACCTCAATGTGGTTCTATTTGCGCCAGAAGATTTGAATATTGTAAAAGGCTCTCCTCAAATAAGACGACGCTTTATAGATATGGAGTTGGGCCAAATTTCTGCTGTTTACTTAAATGATTTAGCTCAATACCAACGTATTTTAAAGCAAAAGAATAATTACTTAAAGCAGTTACAATTAGGCCAAAAAAAGGACTTAACAATGTTGGAAGTATTAAATCAGCAGTTTGCTGAATATGCAATGAAAGTAACTGATAAACGTGCACATTTTATTCAAGAGCTAGAGTCGTTAGCTAAACCGATTCATGCTGGTATCACAAATGATAAAGAAGCGTTGTCGCTGAATTATTTACCTAGTCTTAAATTTGATTATGCTCAAAATGAAGCGGCACGACTTGAAGAAATTATGTCTATTCTTAGCGATAATATGCAAAGAGAAAAAGAACGAGGCATTAGCTTATTCGGACCACATCGAGATGATATAAGTTTTGATGTGAATGGCATGGATGCTCAAACATATGGTTCTCAAGGACAGCAACGTACAACGGCTTTGTCCATTAAATTAGCTGAAATTGAGTTAATGAATATCGAAGTTGGGGAATATCCCATCTTATTATTAGACGATGTACTCAGTGAATTAGATGATTCGCGTCAAACGCATTTATTAAGTACGATTCAGCATAAAGTACAAACATTTGTCACTACGACATCTGTAGATGGTATTGATCATGAAATCATGAATAACGCTAAATTGTATCGTATTAATCAAGGTGAAATTATAAAGTAA
recombination protein F3706.4468842415.1-0.444054Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA replication and repair protein RecFTIGR00611474.6DNA Metabolism / DNA repair / DNA repair, bacterial RecFOR pathway / DNA recombination and repair protein RecF; Cell Division Subsystem including YidCD / DNA recombination and repair protein RecF; Hypothetical Coupled to RecF / DNA recombination and repair protein RecFPF02463SMC_NRecF/RecN/SMC N terminal domainCL0023P-loop_NTPase60.4
SAOUHSC_00187; SAOUHSC_00206; SAOUHSC_00518; SAOUHSC_00519; SAOUHSC_00520; SAOUHSC_00521; SAOUHSC_00529; SAOUHSC_00530; SAOUHSC_00799; SAOUHSC_00878; SAOUHSC_01035; SAOUHSC_01040; SAOUHSC_01041; SAOUHSC_01043; SAOUHSC_01150; SAOUHSC_01211; SAOUHSC_01232; SAOUHSC_01246; SAOUHSC_01416; SAOUHSC_01418; SAOUHSC_01451; SAOUHSC_01757; SAOUHSC_01786; SAOUHSC_01794; SAOUHSC_01801; SAOUHSC_01806; SAOUHSC_01819; SAOUHSC_01829; SAOUHSC_01845; SAOUHSC_02117; SAOUHSC_02316; SAOUHSC_02441; SAOUHSC_02484; SAOUHSC_02486; SAOUHSC_02492; SAOUHSC_02494; SAOUHSC_02496; SAOUHSC_02498; SAOUHSC_02500; SAOUHSC_02503; SAOUHSC_02506; SAOUHSC_02507; SAOUHSC_02509; SAOUHSC_02510; SAOUHSC_02511; SAOUHSC_02512; SAOUHSC_02860; SAOUHSC_02927
CytoplasmicIntracellularno predicted signal peptide088193827Q2G275YP_498612
MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKLYRINQGEIIK
no data available MicrobesOnline: SAOUHSC_00003 > SAOUHSC_00004 > SAOUHSC_00005 > SAOUHSC_0000621166474; 26224020; 28887440
SAOUHSC_00005S. aureus NCTC8325SAUPAN000011000gyrBCDSSAOUHSC_00005DNA gyrase subunit Bchromosome+503469681935yes3919178YP_4986131288505
ATGGTGACTGCATTGTCAGATGTAAACAACACGGATAATTATGGTGCTGGGCAAATACAAGTATTAGAAGGTTTAGAAGCAGTACGTAAAAGACCAGGTATGTATATAGGATCGACTTCAGAGAGAGGTTTGCACCATTTAGTGTGGGAAATTGTCGATAATAGTATCGATGAAGCATTAGCTGGTTATGCAAATCAAATTGAAGTTGTTATTGAAAAAGATAACTGGATTAAAGTAACGGATAACGGACGTGGTATCCCAGTTGATATTCAAGAAAAAATGGGACGTCCAGCTGTCGAAGTTATTTTAACTGTTTTACATGCTGGTGGTAAATTTGGCGGTGGCGGATACAAAGTATCTGGTGGTTTACATGGTGTTGGTTCATCAGTTGTAAACGCATTGTCACAAGACTTAGAAGTATATGTACACAGAAATGAGACTATATATCATCAAGCATATAAAAAAGGTGTACCTCAATTTGACTTAAAAGAAGTTGGCACAACTGATAAGACAGGTACTGTCATTCGTTTTAAAGCAGATGGAGAAATCTTCACAGAGACAACTGTATACAACTATGAAACATTACAGCAGCGTATTAGAGAGCTTGCTTTCTTAAACAAAGGAATTCAAATCACATTAAGAGATGAACGTGATGAAGAAAACGTTAGAGAAGACTCCTATCACTATGAGGGCGGTATTAAATCGTACGTTGAGTTATTGAACGAAAATAAAGAACCTATTCATGATGAGCCAATTTATATTCATCAATCTAAAGATGATATTGAAGTAGAAATTGCGATTCAATATAACTCAGGATATGCCACAAATCTTTTAACTTACGCAAATAACATTCATACGTATGAAGGTGGTACGCATGAAGACGGATTCAAACGTGCATTAACGCGTGTCTTAAATAGTTATGGTTTAAGTAGCAAGATTATGAAAGAAGAAAAAGATAGACTTTCTGGTGAAGATACACGTGAAGGTATGACAGCAATTATATCTATCAAACATGGTGATCCTCAATTCGAAGGTCAAACGAAGACAAAATTAGGTAATTCTGAAGTGCGTCAAGTTGTAGATAAATTATTCTCAGAGCACTTTGAACGATTTTTATATGAAAATCCACAAGTCGCACGTACAGTGGTTGAAAAAGGTATTATGGCGGCACGTGCACGTGTTGCTGCGAAAAAAGCGCGTGAAGTAACACGTCGTAAATCAGCGTTAGATGTAGCAAGCCTTCCAGGTAAATTAGCCGATTGCTCTAGTAAAAGTCCTGAAGAATGTGAGATTTTCTTAGTCGAAGGGGACTCTGCCGGGGGGTCTACAAAATCTGGTCGTGACTCTAGAACGCAGGCGATTTTACCATTACGAGGTAAGATATTAAATGTTGAAAAAGCACGATTAGATAGAATTTTGAATAACAATGAAATTCGTCAAATGATCACAGCATTTGGTACAGGAATCGGTGGCGACTTTGATCTAGCGAAAGCAAGATATCACAAAATCGTCATTATGACTGATGCCGATGTGGATGGAGCGCATATTAGAACATTGTTATTAACATTCTTCTATCGATTTATGAGACCGTTAATTGAAGCAGGCTATGTGTATATTGCACAGCCACCGTTGTATAAACTGACACAAGGTAAACAAAAGTATTATGTATACAATGATAGGGAACTTGATAAACTTAAATCTGAATTGAATCCAACACCAAAATGGTCTATTGCACGATACAAAGGTCTTGGAGAAATGAATGCAGATCAATTATGGGAAACAACAATGAACCCTGAGCACCGCGCTCTTTTACAAGTAAAACTTGAAGATGCGATTGAAGCGGACCAAACATTTGAAATGTTAATGGGTGACGTTGTAGAAAACCGTAGACAATTTATAGAAGATAATGCAGTTTATGCAAACTTAGACTTCTAA
DNA gyrase subunit B6445.6814572539.3-0.4899075.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, B subunitTIGR01059994DNA Metabolism / DNA replication / DNA topoisomerases, Type II, ATP-dependent / DNA gyrase subunit B (EC 5.99.1.3); Virulence, Disease and Defense / Resistance to antibiotics and toxic compounds / Resistance to fluoroquinolones / DNA gyrase subunit B (EC 5.99.1.3); Cell Division Subsystem including YidCD / DNA gyrase subunit B (EC 5.99.1.3)PF00204DNA_gyraseBDNA gyrase BCL0329S5211.1
SAOUHSC_00006; SAOUHSC_00529; SAOUHSC_01246; SAOUHSC_01806
CytoplasmicIntracellularno predicted signal peptide088193828Q2G274YP_498613
MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
no data available MicrobesOnline: SAOUHSC_00003 > SAOUHSC_00004 > SAOUHSC_00005 > SAOUHSC_0000619570206; 21166474; 26224020; 28887440
SAOUHSC_00006S. aureus NCTC8325SAUPAN000012000gyrACDSSAOUHSC_00006DNA gyrase subunit Achromosome+700596682664yes3919179YP_4986141288506
ATGGCTGAATTACCTCAATCAAGAATAAATGAACGAAATATTACCAGTGAAATGCGTGAATCATTTTTAGATTATGCGATGAGTGTTATCGTTGCTCGTGCATTGCCAGATGTTCGTGACGGTTTAAAACCAGTACATCGTCGTATACTATATGGATTAAATGAACAAGGTATGACACCGGATAAATCATATAAAAAATCAGCACGTATCGTTGGTGACGTAATGGGTAAATATCACCCTCATGGTGACTCATCTATTTATGAAGCAATGGTACGTATGGCTCAAGATTTCAGTTATCGTTATCCGCTTGTTGATGGCCAAGGTAACTTTGGTTCAATGGATGGAGATGGCGCAGCAGCAATGCGTTATACTGAAGCGCGTATGACTAAAATCACACTTGAACTGTTACGTGATATTAATAAAGATACAATAGATTTTATCGATAACTATGATGGTAATGAAAGAGAGCCGTCAGTCTTACCTGCTCGATTCCCTAACTTATTAGCCAATGGTGCATCAGGTATCGCGGTAGGTATGGCAACGAATATTCCACCACATAACTTAACAGAATTAATCAATGGTGTACTTAGCTTAAGTAAGAACCCTGATATTTCAATTGCTGAGTTAATGGAGGATATTGAAGGTCCTGATTTCCCAACTGCTGGACTTATTTTAGGTAAGAGTGGTATTAGACGTGCATATGAAACAGGTCGTGGTTCAATTCAAATGCGTTCTCGTGCAGTTATTGAAGAACGTGGAGGCGGACGTCAACGTATTGTTGTCACTGAAATTCCTTTCCAAGTGAATAAGGCTCGTATGATTGAAAAAATTGCAGAGCTCGTTCGTGACAAGAAAATTGACGGTATCACTGATTTACGTGATGAAACAAGTTTACGTACTGGTGTGCGTGTCGTTATTGATGTGCGTAAGGATGCAAATGCTAGTGTCATTTTAAATAACTTATACAAACAAACACCTCTTCAAACATCATTTGGTGTGAATATGATTGCACTTGTAAATGGTAGACCGAAGCTTATTAATTTAAAAGAAGCGTTGGTACATTATTTAGAGCATCAAAAGACAGTTGTTAGAAGACGTACGCAATACAACTTACGTAAAGCTAAAGATCGTGCCCACATTTTAGAAGGATTACGTATCGCACTTGACCATATCGATGAAATTATTTCAACGATTCGTGAGTCAGATACAGATAAAGTTGCAATGGAAAGCTTGCAACAACGCTTCAAACTTTCTGAAAAACAAGCTCAAGCTATTTTAGACATGCGTTTAAGACGTCTAACAGGTTTAGAGAGAGACAAAATTGAAGCTGAATATAATGAGTTATTAAATTATATTAGTGAATTAGAAGCAATCTTAGCTGATGAAGAAGTGTTATTACAGTTAGTTAGAGATGAATTGACTGAAATTAGAGATCGTTTCGGTGATGATCGTCGTACAGAAATTCAATTAGGTGGATTTGAAGACTTAGAGGACGAAGACTTAATTCCAGAAGAACAAATAGTAATTACACTAAGCCATAATAACTACATTAAACGTTTGCCGGTATCTACATATCGTGCTCAAAACCGTGGTGGTCGTGGTGTTCAAGGTATGAATACATTGGAAGAAGATTTTGTCAGTCAATTGGTAACTTTAAGTACACATGACCATGTATTGTTCTTTACTAACAAAGGTCGTGTATACAAACTTAAAGGTTACGAAGTGCCTGAGTTATCAAGACAGTCTAAAGGTATTCCTGTAGTGAATGCTATTGAACTTGAAAATGATGAAGTCATTAGTACAATGATTGCTGTTAAAGACCTTGAAAGTGAAGACAACTTCTTAGTGTTTGCAACTAAACGTGGTGTCGTTAAACGTTCAGCATTAAGTAACTTCTCAAGAATAAATAGAAATGGTAAGATTGCGATTTCGTTCAGAGAAGATGATGAGTTAATTGCAGTTCGCTTAACAAGTGGTCAAGAAGATATCTTGATTGGTACATCACATGCATCATTAATTCGATTCCCTGAATCAACATTACGTCCTTTAGGCCGTACAGCAACGGGTGTGAAAGGTATTACACTTCGTGAAGGTGACGAAGTTGTAGGGCTTGATGTAGCTCATGCAAACAGTGTTGATGAAGTATTAGTAGTTACTGAAAATGGTTATGGTAAACGTACGCCAGTTAATGACTATCGCTTATCAAATCGTGGTGGTAAAGGTATTAAAACAGCTACGATTACTGAGCGTAATGGTAATGTTGTATGTATCACTACAGTAACTGGTGAAGAAGATTTAATGATTGTTACTAATGCAGGTGTCATTATTCGACTAGATGTTGCAGATATTTCTCAAAATGGTCGTGCAGCACAAGGTGTTCGCTTAATTCGCTTAGGTGATGATCAATTTGTTTCAACGGTTGCTAAAGTAAAAGAAGATGCAGAAGATGAAACGAATGAAGATGAGCAATCTACTTCAACTGTATCTGAAGATGGTACTGAACAACAACGTGAAGCGGTTGTAAATGATGAAACACCAGGAAATGCAATTCATACTGAAGTGATTGATTCAGAAGAAAATGATGAAGATGGACGTATTGAAGTAAGACAAGATTTCATGGATCGTGTTGAAGAAGATATACAACAATCATCAGATGAAGAATAA
DNA gyrase subunit A8874.777599350.3-0.4491545.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, A subunitTIGR010631211.3DNA Metabolism / DNA replication / DNA topoisomerases, Type II, ATP-dependent / DNA gyrase subunit A (EC 5.99.1.3); Virulence, Disease and Defense / Resistance to antibiotics and toxic compounds / Resistance to fluoroquinolones / DNA gyrase subunit A (EC 5.99.1.3); Cell Division Subsystem including YidCD / DNA gyrase subunit A (EC 5.99.1.3)PF00521DNA_topoisoIVDNA gyrase/topoisomerase IV, subunit Ano clan definedno clan defined529.8
SAOUHSC_01416
CytoplasmicIntracellularno predicted signal peptide088193829Q2G2Q0YP_498614
MAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELEAILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLGGFEDLEDEDLIPEEQIVITLSHNNYIKRLPVSTYRAQNRGGRGVQGMNTLEEDFVSQLVTLSTHDHVLFFTNKGRVYKLKGYEVPELSRQSKGIPVVNAIELENDEVISTMIAVKDLESEDNFLVFATKRGVVKRSALSNFSRINRNGKIAISFREDDELIAVRLTSGQEDILIGTSHASLIRFPESTLRPLGRTATGVKGITLREGDEVVGLDVAHANSVDEVLVVTENGYGKRTPVNDYRLSNRGGKGIKTATITERNGNVVCITTVTGEEDLMIVTNAGVIIRLDVADISQNGRAAQGVRLIRLGDDQFVSTVAKVKEDAEDETNEDEQSTSTVSEDGTEQQREAVVNDETPGNAIHTEVIDSEENDEDGRIEVRQDFMDRVEEDIQQSSDEE
no data available MicrobesOnline: SAOUHSC_00003 > SAOUHSC_00004 > SAOUHSC_00005 > SAOUHSC_0000619570206; 21166474; 26224020; 28887440; 7492103
SAOUHSC_00007S. aureus NCTC8325SAUPAN000013000nnrDCDSSAOUHSC_00007hypothetical proteinchromosome-975510456702no3919180YP_4986151288507
ATGTTAGCGGCTCGTGCATGTGTATTTAGCGGTAGTGGTTTAATCACTGTAGCTACACATCCAACAAATCATTCAGCATTACATTCTCGTTGCCCAGAAGCGATGGTTATTGATATTAATGATACGAAAATGTTGACGAAAATGATTGAAATGACTGACAGTATACTAATTGGTCCAGGTCTTGGCGTTGATTTCAAAGGAAATAATGCCATTACATTCCTACTACAAAATATACAACCGCATCAAAATTTAATCGTAGACGGCGATGCGATTACAATCTTTAGTAAACTGAAACCGCAATTACCTACATGTCGTGTGATCTTTACACCACACCTCAAAGAATGGGAACGATTAAGTGGTATTCCTATTGAGGAACAGACATATGAGCGTAATCGTGAAGCAGTTGATCGTTTAGGTGCAACTGTTGTACTTAAAAAACATGGTACTGAAATTTTCTTTAAAGATGAAGACTTTAAATTGACAATCGGTAGCCCAGCAATGGCGACTGGTGGTATGGGCGATACACTTGCTGGTATGATTACAAGCTTTGTCGGTCAATTTGATAACTTAAAAGAAGCGGTTATGAGTGCCACATATACACATAGTTTTATTGGCGAAAACCTTGCAAAAGATATGTATGTGGTGCCACCATCAAGACTTATCAATGAAATACCTTACGCAATGAAACAATTAGAAAGTTAG
hypothetical protein2336.153725655.6-0.005150214.2.1.136Unknown functionGeneralYjeF family C-terminal domainTIGR00196137.8ADP-dependent (S)-NAD(P)H-hydrate dehydratase (EC 4.2.1.136)PF01256Carb_kinaseCarbohydrate kinaseCL0118Ribokinase175no significant predictionIntracellularsignal peptide predicted088193830Q2G2P8YP_498615
MLAARACVFSGSGLITVATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQNIQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDRLGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSATYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
no data available 26224020; 28887440
SAOUHSC_00008S. aureus NCTC8325SAUPAN000014000hutHCDSSAOUHSC_00008histidine ammonia-lyasechromosome+10893124071515no3919181YP_4986161288508
ATGACTTTATATTTAGATGGTGAAACACTAACAATTGAGGATATTAAATCATTTTTACAACAACAATCAAAGATTGAAATTATTGATGATGCGTTAGAACGTGTCAAAAAAAGTAGAGCGGTAGTTGAACGTATTATTGAAAATGAGGAAACGGTTTACGGTATTACTACAGGTTTTGGGTTATTTAGTGATGTACGTATAGACCCGACGCAATATAATGAATTACAAGTGAATCTGATACGCTCACATGCCTGTGGACTAGGTGAGCCATTTTCAAAAGAAGTAGCATTAGTCATGATGATTTTACGATTGAATACATTATTAAAAGGTCATTCAGGTGCCACTTTAGAATTAGTGAGACAATTACAATTTTTTATAAATGAACGTATTATACCGATAATCCCACAGCAAGGCTCTCTCGGTGCATCAGGAGATTTAGCGCCATTATCACATTTAGCATTAGCATTAATTGGTGAAGGGAAAGTATTGTACAGAGGGGAAGAAAAGGATAGTGACGATGTATTAAGAGAATTAAATAGACAACCTTTGAACCTTCAGGCTAAAGAAGGTTTAGCATTGATTAATGGTACGCAAGCTATGACAGCTCAAGGTGTCATTAGTTATATAGAAGCAGAAGATTTAGGTTACCAATCTGAATGGATTGCTGCATTAACGCATCAGTCTCTTAATGGCATTATAGATGCATATCGACATGATGTGCACGCAGTTCGTAATTTTCAAGAACAGATTAATGTGGCAGCGCGTATGCGTGATTGGTTAGAAGGATCAACATTAACGACGCGACAATCAGAAATACGTGTACAAGATGCATATACGTTGCGTTGTATACCACAAATCCATGGCGCGAGTTTTCAAGTATTCAATTATGTTAAACAGCAATTAGAATTTGAAATGAATGCGGCTAATGATAATCCACTTATATTTGAGGAAGCAAATGAAACGTTTGTTATTTCAGGTGGTAACTTCCATGGACAACCTATTGCTTTTGCATTAGATCATCTTAAATTAGGTGTAAGTGAATTAGCAAACGTATCGGAACGTCGTCTAGAGCGACTAGTAAATCCTCAATTAAATGGTGATTTACCAGCATTTCTTAGTCCAGAGCCAGGATTGCAAAGTGGCGCGATGATTATGCAATATGCTGCTGCAAGTCTCGTTTCTGAAAATAAAACTTTAGCGCATCCAGCGAGTGTTGATTCTATCACTTCATCTGCGAACCAAGAAGATCACGTATCTATGGGAACTACAGCTGCTAGACATGGTTATCAAATTATTGAAAATGCAAGACGTGTGCTGGCAATCGAATGTGTTATTGCATTACAAGCAGCAGAGTTAAAAGGTGTTGAAGGATTATCACCAAAAACACGTCGCAAGTATGATGAGTTTCGAAGTATCGTGCCATCCATTACACATGATCGTCAATTTCATAAAGATATTGAAGCGGTTGCACAGTATTTAAAGCAATCAATTTATCAAACGACTGCATGTCACTAA
histidine ammonia-lyase5045.1467156075.2-0.1857144.3.1.3MetabolismEnergy metabolismAmino acids and amineshistidine ammonia-lyaseTIGR01225665Amino Acids and Derivatives / Histidine Metabolism / Histidine Degradation / Histidine ammonia-lyase (EC 4.3.1.3)PF00221Lyase_aromaticAromatic amino acid lyaseno clan definedno clan defined612.4CytoplasmicIntracellularno predicted signal peptide088193831Q2G2P7YP_498616
MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERIIENEETVYGITTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRLNTLLKGHSGATLELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVLYRGEEKDSDDVLRELNRQPLNLQAKEGLALINGTQAMTAQGVISYIEAEDLGYQSEWIAALTHQSLNGIIDAYRHDVHAVRNFQEQINVAARMRDWLEGSTLTTRQSEIRVQDAYTLRCIPQIHGASFQVFNYVKQQLEFEMNAANDNPLIFEEANETFVISGGNFHGQPIAFALDHLKLGVSELANVSERRLERLVNPQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTLAHPASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKGVEGLSPKTRRKYDEFRSIVPSITHDRQFHKDIEAVAQYLKQSIYQTTACH
no data available no polycistronic organisation predictedSAOUHSC_01850 *126224020; 28887440
SAOUHSC_00009S. aureus NCTC8325SAUPAN000017000serSCDSSAOUHSC_00009seryl-tRNA synthetasechromosome+12786140721287yes3919182YP_4986171288509
ATGTTAGACATTAGATTATTCAGAAATGAGCCTGACACAGTTAAGAGCAAAATTGAATTACGTGGAGATGATCCAAAAGTTGTAGATGAAATTTTAGAATTGGATGAGCAACGACGTAAATTAATTAGTGCAACAGAAGAAATGAAAGCACGTCGTAATAAAGTAAGCGAAGAAATCGCATTAAAAAAACGTAATAAAGAAAATGCTGATGATGTGATTGCTGAAATGCGCACATTAGGTGACGATATTAAAGAAAAAGATAGTCAATTAAATGAAATTGATAATAAAATGACAGGTATCCTTTGTCGTATTCCAAATTTAATAAGTGATGATGTACCTCAAGGTGAATCTGATGAAGATAACGTTGAAGTTAAAAAGTGGGGTACACCACGTGAGTTTTCATTTGAACCCAAAGCACATTGGGATATTGTAGAAGAATTGAAAATGGCTGATTTTGATCGTGCAGCAAAAGTTTCAGGTGCGCGTTTTGTATATTTAACAAATGAAGGTGCGCAATTAGAGCGTGCTTTAATGAACTATATGATTACAAAACATACAACACAACATGGTTATACAGAAATGATGGTACCACAGCTTGTGAACGCAGATACAATGTATGGTACAGGTCAATTACCTAAATTTGAAGAAGATTTATTTAAAGTAGAAAAAGAAGGATTATATACAATTCCAACTGCTGAAGTACCATTAACGAATTTCTACCGTAATGAAATTATTCAACCAGGTGTACTTCCTGAAAAATTCACTGGTCAATCTGCATGTTTCCGTAGTGAAGCAGGATCAGCAGGTAGAGATACAAGAGGATTAATTCGTTTACATCAATTCGATAAAGTGGAAATGGTACGTTTTGAACAACCTGAAGATTCATGGAATGCTTTAGAAGAAATGACAACAAACGCAGAAGCAATTCTAGAAGAGTTAGGTTTACCATACCGTCGTGTTATTTTATGTACAGGTGATATTGGATTTAGTGCAAGCAAAACATATGATTTAGAAGTTTGGTTACCAAGCTACAATGATTATAAAGAAATTAGTTCATGCTCAAACTGTACGGATTTCCAAGCGCGTCGTGCTAACATCCGCTTCAAGCGTGACAAAGCAGCTAAACCAGAATTAGCACATACATTAAATGGTAGTGGTTTAGCAGTTGGACGTACATTTGCTGCTATTGTTGAAAATTACCAAAATGAAGATGGAACAGTAACAATTCCAGAAGCATTAGTACCATTTATGGGTGGTAAAACACAAATTTCAAAACCAGTTAAATAA
seryl-tRNA synthetase4284.7466548639.7-0.5866826.1.1.11Genetic information processingProtein synthesistRNA aminoacylationserine--tRNA ligaseTIGR00414571.6Amino Acids and Derivatives / Alanine, serine, and glycine / Glycine and Serine Utilization / Seryl-tRNA synthetase (EC 6.1.1.11); Protein Metabolism / Protein biosynthesis / tRNA aminoacylation, Ser / Seryl-tRNA synthetase (EC 6.1.1.11)PF00587tRNA-synt_2btRNA synthetase class II core domain (G, H, P, S and T)CL0040tRNA_synt_II114.8
SAOUHSC_00529; SAOUHSC_00530; SAOUHSC_00795; SAOUHSC_01040; SAOUHSC_01041; SAOUHSC_01042; SAOUHSC_01043; SAOUHSC_01232; SAOUHSC_01418; SAOUHSC_01683; SAOUHSC_01779; SAOUHSC_01806; SAOUHSC_01814; SAOUHSC_02441; SAOUHSC_02509; SAOUHSC_02969
CytoplasmicIntracellularno predicted signal peptide088193832P95689YP_498617
MLDIRLFRNEPDTVKSKIELRGDDPKVVDEILELDEQRRKLISATEEMKARRNKVSEEIALKKRNKENADDVIAEMRTLGDDIKEKDSQLNEIDNKMTGILCRIPNLISDDVPQGESDEDNVEVKKWGTPREFSFEPKAHWDIVEELKMADFDRAAKVSGARFVYLTNEGAQLERALMNYMITKHTTQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVEKEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRDTRGLIRLHQFDKVEMVRFEQPEDSWNALEEMTTNAEAILEELGLPYRRVILCTGDIGFSASKTYDLEVWLPSYNDYKEISSCSNCTDFQARRANIRFKRDKAAKPELAHTLNGSGLAVGRTFAAIVENYQNEDGTVTIPEALVPFMGGKTQISKPVK
no data available no polycistronic organisation predicted19570206; 21166474; 26224020; 28887440; 9565680
SAOUHSC_00010S. aureus NCTC8325SAUPAN000018000-CDSSAOUHSC_00010hypothetical proteinchromosome+1472215417696no3919183YP_4986181288510
ATGACAACACATTTAAGTTTTAGACAAGGCGTGCAAGAGTGTATCCCAACATTATTGGGTTATGCCGGTGTTGGTATTTCATTTGGTATTGTGGCTTCGTCTCAAAACTTTAGTATTTTAGAAATTGTCTTGTTATGTCTTGTTATATATGCCGGTGCTGCGCAATTTATTATGTGCGCGTTGTTTATAGCAGGTACACCTATATCAGCGATTGTACTAACTGTATTTATCGTAAATTCAAGAATGTTCCTTTTAAGTATGTCGCTTGCACCAAACTTCAAGACATATGGGTTTTGGAACCGTGTTGGATTAGGTTCATTAGTAACTGACGAAACGTTTGGCGTCGCCATTACACCTTATTTAAAAGGAGAAGCTATCAATGATCGTTGGATGCATGGTCTTAACATCACAGCATATTTATTTTGGGCAATTTCATGTGTAGCTGGGGCTTTATTTGGCGAATATATCTCAAATCCGCAAACGCTAGGGTTAGATTTTGCTATCACGGCTATGTTTATCTTTTTGGCCATTGCGCAATTTGAATCAATTACTAAATCGCGATTAAGAATTTACATAGTACTCATTATTGCCGTCATAGTAATGATGTTATCGCTAAGTATGTTTATGCCTTCATATCTAGCAATATTAATTGCAGCCACAATTTCAGCAGCGTTAGGAGTGATGATGGAACAATGA
hypothetical protein2316.4902325146.91.04848MetabolismTransport and binding proteinsAmino acids, peptides and aminesazaleucine resistance protein AzlCTIGR0034689.7Branched-chain amino acid permeasePF03591AzlCAzlC proteinno clan definedno clan defined129.3Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide788193833Q2G2P6YP_498618
MTTHLSFRQGVQECIPTLLGYAGVGISFGIVASSQNFSILEIVLLCLVIYAGAAQFIMCALFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPYLKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQFESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMEQ
no data available MicrobesOnline: SAOUHSC_00010 > SAOUHSC_00012
SAOUHSC_00012S. aureus NCTC8325SAUPAN000019000-CDSSAOUHSC_00012hypothetical proteinchromosome+1541415743330no3919184YP_4986191288511
ATGATAACTCATATGAACATGTTAATACTTATTTTATTGTGTGGTATCGTAACGCTATTAATTCGAATTATACCTTTTATCATGATTTCAAAAGTGCAATTGCCTGATGTCGTGGTTCGATGGCTATCATTTATCCCAATCACACTATTTACGGCACTTGTCATTGACAGCATTATTCAACAGACGCCTCATGGTGAGGGGTATACATTAAACATCCCTTACATTATCGCGCTCATTCCGACGGTTATTTTATCTATAATCACGCGTAGTTTAACTATTACAATTATTAGTGGGATTGTTATCATGGCAGCATTACGATTTTTCTTTTAA
hypothetical protein1099.2996112233.11.47523Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein FTIGR021209.3FIG01107951: hypothetical proteinPF05437AzlDBranched-chain amino acid transport protein (AzlD)no clan definedno clan defined83.4Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide488193834Q2G2T5YP_498619
MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQQTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAALRFFF
no data available MicrobesOnline: SAOUHSC_00010 > SAOUHSC_00012
SAOUHSC_00013S. aureus NCTC8325SAUPAN000021000metXCDSSAOUHSC_00013hypothetical proteinchromosome+1610617074969no3919185YP_4986201288512
ATGACAAATTACACAGTAGATACTTTAAATTTAGGGGAATTTATTACAGAATCTGGGGAAGTCATAGATAACTTGCGTTTGAGATATGAGCATGTCGGTTATCATGGACAACCATTAGTTGTAGTTTGTCATGCATTAACTGGCAATCATTTAACATATGGAACAGATGATTATCCGGGTTGGTGGCGAGAAATTATTGATGGGGGATATATACCCATTCACGATTATCAATTTTTAACATTTGATGTTATTGGTAGTCCTTTCGGTTCAAGTTCACCTTTAAACGACCCTCATTTTCCTAAAAAATTAACATTAAGAGATATAGTCAGAGCGAATGAACGAGGTATACAAGCCCTTGGTTATGATAAGATTAATATTTTAATAGGGGGAAGTCTTGGAGGTATGCAAGCAATGGAACTACTCTACAATCAACAGTTTGAAGTAGATAAAGCCATTATCCTTGCTGCAACAAGTCGAACATCATCTTATAGTAGAGCTTTCAATGAAATTGCAAGGCAAGCCATTCATCTTGGTGGTAAGGAAGGTCTAAGTATTGCACGCCAATTAGGTTTTTTGACATATCGATCATCAAAAAGTTATGATGAACGTTTTACGCCGGATGAAGTAGTCGCATACCAACAACATCAAGGTAATAAATTTAAAGAACATTTTGATTTGAATTGTTATCTGACACTGCTAGATGTATTGGATAGTCACAACATTGACCGAGGTCGCACAGACGTAACGCATGTTTTTAAAAATTTAGAAACAAAAGTGTTAACGATGGGGTTCATAGATGATTTGCTATATCCGGATGATCAAGTTCGTGCATTAGGTGAACGTTTTAAATATCATCGTCATTTCTTCGTGCCTGATAATGTTGGGCATGATGGATTCCTACTAAACTTTAGTACCTGGGCACCTAACTTATATCATTTCTTAAATTTAAAGCATTTTAAGCGTAAGTAA
hypothetical protein3226.614736927.4-0.349068MetabolismAmino acid biosynthesisAspartate familyhomoserine O-acetyltransferaseTIGR01392202Amino Acids and Derivatives / Lysine, threonine, methionine, and cysteine / Methionine Biosynthesis / Homoserine O-acetyltransferase (EC 2.3.1.31)PF00561Abhydrolase_1alpha/beta hydrolase foldCL0028AB_hydrolase59.4CytoplasmicIntracellularno predicted signal peptide088193835Q2G2T4YP_498620
MTNYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRK
no data available no polycistronic organisation predictedSAOUHSC_01228 *126224020; 28887440
SAOUHSC_00014S. aureus NCTC8325SAUPAN000023000-CDSSAOUHSC_00014hypothetical proteinchromosome+1736518303939no3919186YP_4986211288513
ATGGGAGTGGCTTATGTGTTTTCAAAAATACAACCTAAAGCAACAATAATTGCAACGATTGCGTTGGTATTTGTCGCTTTAGCTTTATATCTAGTGCCTGGTTTAGGACTAATATTTGCATTATTTGCAACCATACCAGGTATCGTTTTATGGAATAAATCAATACAATCTTTCGGGATTAGTGCACTTATTACAGTAATTATAACAACTGTTTTAGGTAATACTTTCGTTTTAAGTGCCATCATATTAGTCTTAATTGCAAGTTTAATTATTGGTCAATTGCTCAAAGAAAGAACGTCTAAAGAAAGAATATTATACGTAACAACAGTAGCGATGAGCTTAATTTCATTAATCGCTTTTATGTTACTACAAACATTCGGAAGGATTCCACCATCAGCGAGCATAGTAAAACCTTTCAAGCAAACATTACATGAAGCGATTACGATGAGCGGTGCCGATGCGAATATGACCCAAATATTAGAAGAAGGGTTTAGACAAGCGACCGTTCAATTACCAGGTTTCATCATTATCATTACATTTTTAATCGTCTTAATTAACTTAATCGTTACATTTCCGATTTTACGAAAATTTAAAATCGCTACACCTGTATTTAAGCCACTTTTCGCGTGGCAAATGAGCGGTATTTTATTATGGATATACATTATTGTTATCATATGTTTATTATTTACAGGTCAACCGAGTGTGTTCCAGAGCATTCTTTTAAACTTCCAACTTGTGTTATCATTAGTAATGTATATTCAAGGTTTAAGTGTTATTCATTTCTTTGGTAAAGCGAAAGGTTTGCCGAATGCAGTAACGATTTTACTATTGGTTATCGGTACAATACTGACACCTACGACACATATTGTAGGACTACTTGGTGTTATCGATTTAAGTTTGAATTTGAAGCGAATCATGAAAAATAATTCTAAAAAGTGA
hypothetical protein31210.865834148.51.14551CBSS-262719.3.peg.410 / FIG003573: hypothetical proteinPF09991DUF2232Predicted membrane protein (DUF2232)no clan definedno clan defined212.7Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide788193836Q2G2T2YP_498621
MGVAYVFSKIQPKATIIATIALVFVALALYLVPGLGLIFALFATIPGIVLWNKSIQSFGISALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSKERILYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILEEGFRQATVQLPGFIIIITFLIVLINLIVTFPILRKFKIATPVFKPLFAWQMSGILLWIYIIVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLVIGTILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
no data available MicrobesOnline: SAOUHSC_00014 > SAOUHSC_00015 > SAOUHSC_00017 > SAOUHSC_0001826224020; 28887440
SAOUHSC_00015S. aureus NCTC8325SAUPAN000024000-CDSSAOUHSC_00015hypothetical proteinchromosome+18318202851968yes3919187YP_4986221288514
ATGAATCGGCAGTCCACTAAGAAAGCTTTACTAATACCATTTGTCATCATGATCATCACAGCAATTGTTTTAATGGGTGTATGGTTTATCTTTAATAGTCTTATAGCACTAATTGCATCTATCGTTCTTGTCGTGATGATTATTGTTAGCATCATTTTATTCAGACAAGCTTTAATGAAAATGGATAGTTATGTAGATGGTTTGAGTGCTCAAATTTCAACAACAAATAATAAAGCAATCAAACATTTACCAATTGGTATCATTGTTTTAGATGAAAATGATCACATCGAATGGGTTAACCAATTTATGACAGATCATATGGAAGCGAATGTCATTTCTGAATCTGTAAATGAAGTATTTCCAAACATTTTAAAGCAATTAGATAGAGTGAAATCCGTTGAAATAGAATATAATCAGTATCATTTCCAAGTACGTTATTCTGAGAATGATCACTGCCTCTATTTCTTTGATATAACTGAACAAGTACAAACAAATGAACTATATGAAAATTCTAAACCAATCATTGCGACATTATTTTTAGATAACTACGATGAGATTACGCAAAATATGAATGATACGCAGCGTTCGGAAATCAACTCAATGGTAACGCGTGTCATTAGTCGATGGGCAACTGAGTATAATATATTTTTCAAAAGATACAGTTCCGATCAATTCGTAGCCTATTTAAATCAAAAAATATTAGCTGACTTAGAAGAATCTAAATTTGATATCTTGAGTCAATTACGTGAAAAAAGTGTTGGTTATCGTGCCCAATTAACATTAAGTATCGGTGTTGGTGAAGGTACTGAAAATTTAATCGACTTAGGTGAATTATCACAATCAGGCCTAGACTTAGCATTAGGACGCGGTGGCGACCAAGTTGCAATTAAAAGTATTAATGGTAATGTGCGTTTCTATGGCGGTAAGACTGACCCGATGGAGAAACGTACTCGTGTAAGAGCACGTGTGATCTCACATGCGTTAAAAGATATCCTTGCAGAGGGTGACAAAGTCATTATCATGGGACATAAACGTCCTGACTTAGATGCAATTGGTGCAGCAATCGGTGTGTCTAGATTTGCAATGATGAATAATTTAGAAGCATACATCGTATTAAATGAGACTGACATTGATCCAACATTACGACGCGTGATGAACGAAATAGATAAAAAGCCAGAGTTAAGAGAGCGATTTATTACATCAGATGATGCTTGGGATATGATGACATCTAAGACAACCGTAGTGATTGTTGATACGCATAAACCGGAACTGGTTTTAGATGAAAATGTCTTAAATAAAGCAAACCGTAAAGTTGTTATCGATCATCATAGACGTGGTGAAAGCTTCATCTCTAATCCATTGTTGATATATATGGAACCATACGCAAGTTCGACAGCTGAATTGGTAACAGAGTTACTGGAATATCAACCAACAGAACAACGTTTAACACGTCTTGAATCAACAGTGATGTATGCAGGTATTATTGTAGATACAAGAAACTTTACATTACGAACAGGATCAAGAACATTCGATGCAGCGAGTTATTTACGTGCACATGGTGCAGATACGATTTTAACGCAACATTTCTTAAAAGATGATGTGGATACTTACATTAATCGATCTGAATTAATTCGAACTGTAAAAGTTGAAGATAATGGCATAGCCATTGCGCATGGTTCAGACGATAAAATTTATCATCCAGTAACAGTTGCACAAGCAGCAGATGAACTGTTAAGTTTAGAAGGTATTGAAGCATCATATGTTGTTGCGAGACGTGAAGATAATCTGATTGGTATATCTGCGCGTTCACTCGGTTCAGTAAATGTCCAGTTAACAATGGAAGCACTTGGTGGCGGTGGACATTTAACCAATGCGGCAACACAACTTAAAGGTGTGACAGTCGAAGAGGCGATAGCACAATTACAACAAGCAATTACAGAACAATTAAGTAGGAGTGAAGATGCATGA
hypothetical protein6554.9008373780.7-0.110229Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR0296617.5CBSS-262719.3.peg.410 / Phosphoesterase, DHH family proteinPF01368DHHDHH familyCL0137HAD79.2CytoplasmicMulti-transmembraneno predicted signal peptide288193837Q2G2T6YP_498622
MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMKMDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTDHMEANVISESVNEVFPNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFLDNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEESKFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSINGNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRFAMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFITSDDAWDMMTSKTTVVIVDTHKPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQRLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINRSELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGISARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
no data available MicrobesOnline: SAOUHSC_00014 > SAOUHSC_00015 > SAOUHSC_00017 > SAOUHSC_0001819570206; 26224020; 28887440
SAOUHSC_00017S. aureus NCTC8325SAUPAN000025000rplICDSrplI50S ribosomal protein L9chromosome+2028220734453no3919188YP_4986231288515
ATGAAAGTAATTTTTACACAAGATGTTAAAGGTAAAGGTAAAGGTAAAAAAGGTGAAGTTAAAGAAGTACCAGTAGGTTATGCAAATAACTTCTTATTGAAAAAGAATTATGCTGTAGAAGCAACACCAGGTAACCTTAAACAATTAGAGTTACAGAAAAAACGTGCAAAACAAGAACGCCAACAAGAAATTGAAGATGCTAAAGCATTAAAAGAAACGTTATCAAACATTGAAGTTGAAGTATCAGCAAAAACTGGTGAAGGTGGTAAATTGTTTGGGTCAGTAAGTACAAAACAAATTGCCGAAGCACTAAAAGCACAACATGATATTAAAATTGATAAACGTAAAATGGATTTACCAAATGGAATTCATTCCCTAGGATATACGAATGTACCTGTTAAATTAGATAAAGAAGTTGAAGGTACAATTCGCGTACACACAGTTGAACAATAA
50S ribosomal protein L915010.153316639.1-0.701333Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL9TIGR00158144Protein Metabolism / Protein biosynthesis / Ribosome LSU bacterial / LSU ribosomal protein L9p; CBSS-262719.3.peg.410 / LSU ribosomal protein L9pPF03948Ribosomal_L9_CRibosomal protein L9, C-terminal domainno clan definedno clan defined98.6
SAOUHSC_00426; SAOUHSC_00518; SAOUHSC_00520; SAOUHSC_00679; SAOUHSC_01806; SAOUHSC_02511
CytoplasmicIntracellularno predicted signal peptide088193838Q2G2T3YP_498623
MKVIFTQDVKGKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
no data available MicrobesOnline: SAOUHSC_00014 > SAOUHSC_00015 > SAOUHSC_00017 > SAOUHSC_0001819570206; 21166474; 26224020; 28887440
SAOUHSC_00018S. aureus NCTC8325SAUPAN000026000dnaCCDSSAOUHSC_00018replicative DNA helicasechromosome+20766221661401yes3919189YP_4986241288516
ATGGATAGAATGTATGAGCAAAATCAAATGCCGCATAACAATGAAGCTGAACAGTCTGTCTTAGGTTCAATTATTATAGATCCAGAATTGATTAATACTACTCAGGAAGTTTTGCTTCCTGAGTCGTTTTATAGGGGTGCCCATCAACATATTTTCCGTGCAATGATGCACTTAAATGAAGATAATAAAGAAATTGATGTTGTAACATTGATGGATCAATTATCGACGGAAGGTACGTTGAATGAAGCGGGTGGCCCGCAATATCTTGCAGAGTTATCTACAAATGTACCAACGACGCGAAATGTTCAGTATTATACTGATATCGTTTCTAAGCATGCATTAAAACGTAGATTGATTCAAACTGCAGATAGTATTGCCAATGATGGATATAATGATGAACTTGAACTAGATGCGATTTTAAGTGATGCAGAACGTCGAATTTTAGAGCTATCATCTTCTCGTGAAAGCGATGGCTTTAAAGACATTCGAGACGTCTTAGGACAAGTGTATGAAACAGCTGAAGAGCTTGATCAAAATAGTGGTCAAACACCAGGTATACCTACAGGATATCGAGATTTAGACCAAATGACAGCAGGGTTCAACCGAAATGATTTAATTATCCTTGCAGCGCGTCCATCTGTAGGTAAGACTGCGTTCGCACTTAATATTGCACAAAAAGTTGCAACGCATGAAGATATGTATACAGTTGGTATTTTCTCGCTAGAGATGGGTGCTGATCAGTTAGCCACACGTATGATTTGTAGTTCTGGAAATGTTGACTCAAACCGCTTAAGAACGGGTACTATGACTGAGGAAGATTGGAGTCGTTTTACTATAGCGGTAGGTAAATTATCACGTACGAAGATTTTTATTGATGATACACCGGGTATTCGAATTAATGATTTACGTTCTAAATGTCGTCGATTAAAGCAAGAACATGGCTTAGACATGATTGTGATTGACTACTTACAGTTGATTCAAGGTAGTGGTTCACGTGCGTCCGATAACAGACAACAGGAAGTTTCTGAAATCTCTCGTACATTAAAAGCATTAGCCCGTGAATTAAAATGTCCAGTTATCGCATTAAGTCAGTTATCTCGTGGTGTTGAACAACGACAAGATAAACGTCCAATGATGAGTGATATTCGTGAATCTGGTTCGATTGAGCAAGATGCCGATATCGTTGCATTCTTATACCGTGATGATTACTATAACCGTGGCGGCGATGAAGATGATGACGATGATGGTGGTTTCGAGCCACAAACGAATGATGAAAACGGTGAAATTGAAATTATCATTGCTAAGCAACGTAACGGTCCAACAGGCACAGTTAAGTTACATTTTATGAAACAATATAATAAATTTACCGATATCGATTATGCACATGCAGATATGATGTAA
replicative DNA helicase4664.4650852570.3-0.5916313.6.1.-; 3.6.4.12Genetic information processingDNA metabolismDNA replication, recombination, and repairreplicative DNA helicaseTIGR00665585.3CBSS-262719.3.peg.410 / Replicative DNA helicase (DnaB) (EC 3.6.4.12); DNA-replication / Replicative DNA helicase (DnaB) (EC 3.6.4.12)PF03796DnaB_CDnaB-like helicase C terminal domainCL0023P-loop_NTPase384
SAOUHSC_00679; SAOUHSC_01801; SAOUHSC_02494
CytoplasmicIntracellularno predicted signal peptide088193839Q2G1S4YP_498624
MDRMYEQNQMPHNNEAEQSVLGSIIIDPELINTTQEVLLPESFYRGAHQHIFRAMMHLNEDNKEIDVVTLMDQLSTEGTLNEAGGPQYLAELSTNVPTTRNVQYYTDIVSKHALKRRLIQTADSIANDGYNDELELDAILSDAERRILELSSSRESDGFKDIRDVLGQVYETAEELDQNSGQTPGIPTGYRDLDQMTAGFNRNDLIILAARPSVGKTAFALNIAQKVATHEDMYTVGIFSLEMGADQLATRMICSSGNVDSNRLRTGTMTEEDWSRFTIAVGKLSRTKIFIDDTPGIRINDLRSKCRRLKQEHGLDMIVIDYLQLIQGSGSRASDNRQQEVSEISRTLKALARELKCPVIALSQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNRGGDEDDDDDGGFEPQTNDENGEIEIIIAKQRNGPTGTVKLHFMKQYNKFTDIDYAHADMM
no data available MicrobesOnline: SAOUHSC_00014 > SAOUHSC_00015 > SAOUHSC_00017 > SAOUHSC_0001819570206; 21166474; 26224020; 28887440
SAOUHSC_00019S. aureus NCTC8325SAUPAN000028000purACDSSAOUHSC_00019adenylosuccinate synthetasechromosome+22444237271284no3919190YP_4986251288517
ATGTCATCAATCGTAGTAGTTGGGACACAATGGGGAGACGAAGGAAAAGGAAAAATAACGGATTTCTTGGCAGAACAGTCAGATGTTATCGCGCGTTTTTCAGGTGGTAATAATGCAGGCCATACCATTCAATTTGGCGGAGAAACATATAAATTACATTTAGTACCATCTGGTATCTTTTACAAAGACAAATTAGCGGTAATCGGTAACGGAGTCGTTGTTGATCCAGTTGCACTATTGAAAGAATTAGACGGATTAAATGAACGTGGCATTCCTACAAGTAATTTACGTATATCTAATCGTGCGCAAGTGATTTTACCATATCACTTAGCACAAGATGAATATGAAGAACGTTTACGTGGTGACAATAAGATTGGTACAACTAAAAAAGGTATCGGTCCAGCATATGTAGACAAAGTTCAACGTATCGGTATTCGTATGGCAGATTTACTTGAAAAAGAAACATTCGAAAGATTATTAAAATCAAACATTGAATATAAACAAGCATATTTCAAAGGTATGTTTAACGAAACATGTCCATCATTTGATGATATCTTTGAAGAATATTATGCAGCAGGTCAACGTCTAAAAGAATTTGTAACAGACACATCAAAAATCTTAGACGATGCATTTGTAGCAGATGAAAAGGTACTTTTCGAAGGTGCGCAAGGTGTAATGTTAGATATCGACCATGGTACATATCCATTCGTTACATCAAGTAATCCAATTGCAGGTAACGTTACTGTTGGTACAGGTGTAGGTCCTACATTCGTTTCAAAGGTAATTGGTGTATGTAAAGCTTATACATCACGTGTTGGTGATGGTCCATTCCCTACTGAATTATTCGATGAAGATGGACATCATATTAGAGAGGTTGGTCGTGAATACGGTACAACAACAGGACGTCCACGTCGTGTAGGTTGGTTTGATTCAGTTGTATTACGTCACTCTCGTCGTGTAAGTGGTATTACAGATTTATCTATTAACTCAATCGATGTTTTAACAGGCCTAGACACAGTGAAAATCTGTACAGCTTATGAATTAGACGGTAAAGAAATTACTGAGTACCCAGCAAACTTAGATCAATTAAAACGTTGTAAACCAATCTTTGAAGAGTTACCAGGTTGGACAGAAGACGTAACAAATGTGCGTACTTTAGAAGAATTACCTGAAAATGCACGTAAATATTTAGAGCGTATTTCAGAATTATGTAATGTACAAATTTCTATCTTCTCAGTTGGTCCAGATAGAGAACAAACAAACCTATTAAAAGAATTGTGGTAG
adenylosuccinate synthetase4274.8564547578.4-0.3065576.3.4.4MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisadenylosuccinate synthaseTIGR00184595Miscellaneous / Miscellaneous - no subcategory / EC 6.3.4.- Ligases that form carbon-nitrogen bonds / Adenylosuccinate synthetase (EC 6.3.4.4); Nucleosides and Nucleotides / Purines / Purine conversions / Adenylosuccinate synthetase (EC 6.3.4.4); CBSS-262719.3.peg.410 / Adenylosuccinate synthetase (EC 6.3.4.4)PF00709Adenylsucc_syntAdenylosuccinate synthetaseCL0023P-loop_NTPase588.1
SAOUHSC_00017; SAOUHSC_00069; SAOUHSC_00187; SAOUHSC_00348; SAOUHSC_00350; SAOUHSC_00365; SAOUHSC_00371; SAOUHSC_00374; SAOUHSC_00488; SAOUHSC_00499; SAOUHSC_00518; SAOUHSC_00519; SAOUHSC_00520; SAOUHSC_00521; SAOUHSC_00525; SAOUHSC_00527; SAOUHSC_00528; SAOUHSC_00529; SAOUHSC_00530; SAOUHSC_00574; SAOUHSC_00634; SAOUHSC_00767; SAOUHSC_00795; SAOUHSC_00796; SAOUHSC_00797; SAOUHSC_00799; SAOUHSC_00835; SAOUHSC_00847; SAOUHSC_00878; SAOUHSC_00895; SAOUHSC_00900; SAOUHSC_00906; SAOUHSC_00947; SAOUHSC_00951; SAOUHSC_01028; SAOUHSC_01029; SAOUHSC_01040; SAOUHSC_01042; SAOUHSC_01043; SAOUHSC_01100; SAOUHSC_01150; SAOUHSC_01201; SAOUHSC_01208; SAOUHSC_01211; SAOUHSC_01232; SAOUHSC_01234; SAOUHSC_01250; SAOUHSC_01287; SAOUHSC_01327; SAOUHSC_01337; SAOUHSC_01347; SAOUHSC_01416; SAOUHSC_01430; SAOUHSC_01485; SAOUHSC_01490; SAOUHSC_01493; SAOUHSC_01605; SAOUHSC_01653; SAOUHSC_01683; SAOUHSC_01755; SAOUHSC_01757; SAOUHSC_01779; SAOUHSC_01784; SAOUHSC_01786; SAOUHSC_01794; SAOUHSC_01801; SAOUHSC_01806; SAOUHSC_01807; SAOU
CytoplasmicIntracellularno predicted signal peptide088193840Q2G1S3YP_498625
MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTNVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELW
no data available no polycistronic organisation predicted21166474; 26224020; 28887440
SAOUHSC_T00018S. aureus NCTC8325SAUPAN000029000trnaEtRNASAOUHSC_T00018tRNA-Gluchromosome+241572423175unknown392133710161681
GGCTCCTTGGTCAAGCGGTTAAGACACCGCCCTTTCACGGCGGTAACACGGGTTCGAGTCCCGTAGGAGTCACCA
tRNA-Glu0no predicted signal peptideno data available no polycistronic organisation predicted
SAOUHSC_T00011S. aureus NCTC8325SAUPAN000030000trnaDtRNASAOUHSC_T00011tRNA-Aspchromosome+242392431173unknown39213301288519
GGTCTCGTAGTGTAGCGGTTAACACGCCTGCCTGTCACGCAGGAGATCGCGGGTTCGATTCCCGTCGAGACCG
tRNA-Asp0no predicted signal peptideno data available no polycistronic organisation predicted
SAOUHSC_00020S. aureus NCTC8325SAUPAN000032000walRCDSSAOUHSC_00020two-component response regulatorchromosome+2493125632702yes3919191YP_4986261288520
ATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTTAACTTAAAAAAAGAAGGATACGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGACTTAATTTATGAAGAAGAACCAGACATCGTATTACTAGATATCATGTTACCTGGTCGTGATGGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATAATAATGCTTACTGCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTAACGAAACCGTTTAGTACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCATTACTCACAACCAGCACAAGACACTGGAAATGTAACGAATGAAATCACAATTAAAGATATTGTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTAACACATCGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAACATTTATTACAAACAGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTAACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGTCACATCCTGAATATATTGTGACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG
two-component response regulator2334.8121127191.8-0.475536Signal transductionRegulatory functions; Signal transductionDNA interactions; Two-component systemsphosphate regulon transcriptional regulatory protein PhoBTIGR02154235.8Iron acquisition and metabolism / Iron acquisition and metabolism - no subcategory / Heme, hemin uptake and utilization systems in GramPositives / Two-component response regulator SA14-24PF00072Response_regResponse regulator receiver domainCL0304CheY103.1
SAOUHSC_00426; SAOUHSC_00488; SAOUHSC_01042; SAOUHSC_01232; SAOUHSC_01493; SAOUHSC_02353; SAOUHSC_02506; SAOUHSC_02927
CytoplasmicIntracellularno predicted signal peptide088193841Q2G2U6YP_498626
MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
no data available MicrobesOnline: SAOUHSC_00020 > SAOUHSC_00021 > SAOUHSC_00022 > SAOUHSC_00023SAOUHSC_02273 *110368139; 14762013; 17827301; 19570206; 21166474; 22825451; 26224020; 28887440
SAOUHSC_00021S. aureus NCTC8325SAUPAN000033000walKCDSSAOUHSC_00021sensory box histidine kinase VicKchromosome+25645274711827yes3919192YP_4986271288521
ATGAAGTGGCTAAAACAACTACAATCCCTTCATACTAAACTTGTAATTGTTTATGTATTACTGATTATCATTGGTATGCAAATTATCGGGTTATATTTTACAAATAACCTTGAAAAAGAGCTGCTTGATAATTTTAAGAAGAATATTACGCAGTACGCGAAACAATTAGAAATTAGTATTGAAAAAGTATATGACGAAAAGGGCTCCGTAAATGCACAAAAAGATATTCAAAATTTATTAAGTGAGTATGCCAACCGTCAAGAAATTGGAGAAATTCGTTTTATAGATAAAGACCAAATTATTATTGCGACGACGAAGCAGTCTAACCGTAGTCTAATCAATCAAAAAGCGAATGATAGTTCTGTCCAAAAAGCACTATCACTAGGACAATCAAACGATCATTTAATTTTAAAAGATTATGGCGGTGGTAAGGACCGTGTCTGGGTATATAATATCCCAGTTAAAGTCGATAAAAAGGTAATTGGTAATATTTATATCGAATCAAAAATTAATGACGTTTATAACCAATTAAATAATATAAATCAAATATTCATTGTTGGTACAGCTATTTCATTATTAATCACAGTCATCCTAGGATTCTTTATAGCGCGAACGATTACCAAACCAATCACCGATATGCGTAACCAGACGGTCGAAATGTCCAGAGGTAACTATACGCAACGTGTGAAGATTTATGGTAATGATGAAATTGGCGAATTAGCTTTAGCATTTAATAACTTGTCTAAACGTGTACAAGAAGCGCAGGCTAATACTGAAAGTGAGAAACGTAGACTGGACTCAGTTATCACCCATATGAGTGATGGTATTATTGCAACAGACCGCCGTGGACGTATTCGTATCGTCAATGATATGGCACTCAAGATGCTTGGTATGGCGAAAGAAGACATCATCGGATATTACATGTTAAGTGTATTAAGTCTTGAAGATGAATTTAAACTGGAAGAAATTCAAGAGAATAATGATAGTTTCTTATTAGATTTAAATGAAGAAGAAGGTCTAATCGCACGTGTTAACTTTAGTACGATTGTGCAGGAAACAGGATTTGTAACTGGTTATATCGCTGTGTTACATGACGTAACTGAACAACAACAAGTTGAACGTGAGCGTCGTGAATTTGTTGCCAATGTATCACATGAGTTACGTACACCTTTAACTTCTATGAATAGTTACATTGAAGCACTTGAAGAAGGTGCATGGAAAGATGAGGAACTTGCGCCACAATTTTTATCTGTTACCCGTGAAGAAACAGAACGAATGATTCGACTGGTCAATGACTTGCTACAGTTATCTAAAATGGATAATGAGTCTGATCAAATCAACAAAGAAATTATCGACTTTAACATGTTCATTAATAAAATTATTAATCGACATGAAATGTCTGCGAAAGATACAACATTTATTCGAGATATTCCGAAAAAGACGATTTTCACAGAATTTGATCCTGATAAAATGACGCAAGTATTTGATAATGTCATTACAAATGCGATGAAATATTCTAGAGGCGATAAACGTGTCGAGTTCCACGTGAAACAAAATCCACTTTATAATCGAATGACGATTCGTATTAAAGATAATGGCATTGGTATTCCTATCAATAAAGTCGATAAGATATTCGACCGATTCTATCGTGTAGATAAGGCACGTACGCGTAAAATGGGTGGTACTGGATTAGGACTAGCCATTTCGAAAGAGATTGTGGAAGCGCACAATGGTCGTATTTGGGCAAACAGTGTAGAAGGTCAAGGTACATCTATCTTTATCACACTTCCATGTGAAGTCATTGAAGACGGTGATTGGGATGAATAA
sensory box histidine kinase VicK6085.3988369923.5-0.3537832.7.13.3; 2.7.3.-Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR02966248Iron acquisition and metabolism / Iron acquisition and metabolism - no subcategory / Heme, hemin uptake and utilization systems in GramPositives / Two-component sensor kinase SA14-24PF02518HATPase_cHistidine kinase-, DNA gyrase B-, and HSP90-like ATPaseCL0025His_Kinase_A92.8
SAOUHSC_00020; SAOUHSC_01232; SAOUHSC_02494
Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide288193842Q2G2U4YP_498627
MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNINQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEVIEDGDWDE
no data available MicrobesOnline: SAOUHSC_00020 > SAOUHSC_00021 > SAOUHSC_00022 > SAOUHSC_00023SAOUHSC_02273 *110368139; 14762013; 17827301; 19570206; 21166474; 22825451; 26224020; 28887440
SAOUHSC_00022S. aureus NCTC8325SAUPAN000034000walHCDSSAOUHSC_00022hypothetical proteinchromosome+27515287981284no3919193YP_4986281288522
ATGAGTGTCGTATTGACATATATGGTATGGAACTTTTCTCCTGATATTGCAAATGTCGACAATACAGATAGTAAGAAGAGTGAAACGAAACCTTTAACGACACCTATGACAGCCAAAATGGATACAACTATTACGCCATTTCAGATTATTCATTCGAAAAATGATCATCCAGAAGGAACGATTGCGACGGTATCTAATGTGAATAAACTGACGAAACCTTTGAAAAATAAAGAAGTGAAGTCCGTGGAACATGTTCGTCGTGATCATAACTTGATGATTCCTGATTTGAACAGTGATTTTATATTATTCGATTTTACGTATGATTTACCGTTATCAACATATCTTGGTCAAGTACTGAACATGAATGCGAAAGTACCAAATCATTTCAATTTCAATCGTTTGGTCATAGATCATGATGCTGATGATAATATCGTGCTTTATGCTATAAGCAAAGATCGCCACGATTACGTAAAATTAACAACTACAACGAAAAATGATCATTTTTTAGATGCATTAGCAGCAGTGAAAAAAGATATGCAACCATACACAGATATCATCACAAACAAAGATACAATTGATCGTACGACGCATGTTTTTGCACCAAGTAAACCTGAAAAGTTAAAAACATATCGCATGGTATTTAACACGATTAGTGTTGAGAAAATGAATGCTATACTATTTGACGATTCAACCATCGTTCGTAGTTCAAAGAGTGGTGTTACAACCTACAACAATAATACAGGTGTCGCAAACTATAACGATAAAAATGAAAAATATCATTATAAAAACCTGTCCGAAGATGAAGCGAGTTCCAGCAAAATGGAAGAAACGATTCCAGGAACCTTTGATTTTATTAATGGTCATGGTGGTTTCTTAAACGAAGACTTTAGATTGTTTAGTACGAATAATCAGTCAGGCGAGTTAACATATCAACGTTTCCTTAATGGTTATCCAACGTTTAATAAAGAAGGTTCTAATCAAATTCAAGTCACTTGGGGTGAAAAAGGCGTCTTTGACTATCGTCGTTCGTTATTACGCACCGACGTTGTTTTAAATAGTGAGGATAATAAATCGTTGCCGAAATTAGAGTCTGTACGTTCAAGCTTAGCGAACAATAGTGATATTAATTTTGAAAAAGTAACAAACATCGCTATCGGTTACGAAATGCAGGATAATTCAGATCATAATCACATTGAAGTGCAGATTAACAGTGAACTCGTACCGCGTTGGTATGTAGAATATGATGGCGAATGGTATGTTTATAACGATGGGAGGCTTGAATAA
hypothetical protein4275.4443549007.3-0.641452Cofactors, Vitamins, Prosthetic Groups, Pigments / Tetrapyrroles / CPO analysis / FIG011501: YycH proteinPF07435YycHYycH proteinCL0285YycI_YycH427.4no significant predictionIntracellularno predicted signal peptide088193843Q2G2U3YP_498628
MSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTTPMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIPDLNSDFILFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRHDYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVFNTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKMEETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGEKGVFDYRRSLLRTDVVLNSEDNKSLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSDHNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
no data available MicrobesOnline: SAOUHSC_00020 > SAOUHSC_00021 > SAOUHSC_00022 > SAOUHSC_0002326224020; 26999783; 28887440
SAOUHSC_00023S. aureus NCTC8325SAUPAN000035000walICDSSAOUHSC_00023hypothetical proteinchromosome+2879929587789no3919194YP_4986291288523
ATGAACTGGAAACTGACAAAGACACTTTTCATTTTCGTGTTTATTCTTGTCAACATCGTGTTAGTATCGATTTATGTTAATAAAGTCAATCGCTCACACATTAATGAAGTCGAGAGTAACAATGAAGTTAATTTTCAGCAAGAAGAAATTAAAGTACCGACTAGTATATTGAATAAATCAGTTAAAGGTATAAAATTAGAGCAAATTACAGGGCGATCAAAAGACTTTAGTTCTAAAGCTAAAGGCGATTCGGATTTGACCACATCAGATGGTGGAAAATTATTGAATGCGAACATTAGTCAATCGGTAAAGGTCAGTGACAATAACTTAAAAGATTTGAAAGATTATGTTAACAAGCGCGTATTTAAAGGTGCTGAATATCAATTAAGCGAGATTAGTTCAGATTCTGTAAAATATGAACAAACGTATGATGATTTTCCGATTTTAAATAACAGTAAAGCGATGTTAAACTTTAATATAGAAGATAACAAAGCGACTAGTTATAAACAATCAATGATGGATGACATTAAGCCCACAGATGGTGCAGATAAGAAGCATCAAGTGATTGGTGTGAGAAAAGCAATCGAGGCATTATATTATAATCGTTACTTGAAAAAAGGTGATGAAGTCATTAATGCTAGACTCGGTTACTACTCAGTCGTGAATGAAACGAATGTTCAATTGTTACAACCAAACTGGGAAATTAAAGTGAAGCATGACGGTAAGGATAAAACGAATACTTACTATGTCGAAGCGACAAATAATAACCCTAAAATTATTAATCATTAA
hypothetical protein2629.3692429931.6-0.621756Cofactors, Vitamins, Prosthetic Groups, Pigments / Tetrapyrroles / CPO analysis / hypothetical protein SA_21PF09648YycIYycH proteinCL0285YycI_YycH175no significant predictionN-terminally anchored (No CS)no predicted signal peptide188193844Q2G2U2YP_498629
MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPTSILNKSVKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKRVFKGAEYQLSEISSDSVKYEQTYDDFPILNNSKAMLNFNIEDNKATSYKQSMMDDIKPTDGADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHDGKDKTNTYYVEATNNNPKIINH
no data available MicrobesOnline: SAOUHSC_00020 > SAOUHSC_00021 > SAOUHSC_00022 > SAOUHSC_0002326224020; 26999783; 28887440
SAOUHSC_00024S. aureus NCTC8325SAUPAN000036000walJCDSSAOUHSC_00024hypothetical proteinchromosome+2997730777801no3919195YP_4986301288524
ATGAGCCGCTTGATACGCATGAGTGTATTAGCAAGTGGTAGTACAGGTAACGCCACTTTTGTAGAAAATGAAAAAGGTAGTCTATTAGTTGATGTTGGTTTGACTGGAAAGAAAATGGAAGAATTGTTTAGTCAAATTGACCGTAATATTCAAGATTTAAATGGTATTTTAGTAACCCATGAACATATTGATCATATTAAAGGATTAGGTGTTTTGGCGCGTAAATATCAATTGCCAATTTATGCGAATGAAAAAACTTGGCAGGCAATTGAAAAGAAAGATAGTCGCATCCCTATGGATCAGAAATTCATTTTTAATCCTTATGAAACAAAATCTATTGCAGGTTTCGATGTTGAATCGTTTAACGTGTCACATGATGCAATAGATCCGCAATTTTATATTTTCCATAATAACTATAAGAAGTTTACGATTTTAACGGATACGGGTTACGTGTCTGATCGTATGAAAGGTATGATACGTGGCAGCGATGCGTTTATTTTTGAGAGTAATCATGACGTCGATATGTTGAGAATGTGTCGTTATCCATGGAAGACGAAACAACGTATTTTAGGCGATATGGGTCATGTATCTAATGAGGATGCGGCTCATGCAATGACAGACGTGATTACAGGTAACACGAAACGTATTTACCTATCGCATTTATCACAAGACAATAACATGAAAGATTTGGCGCGTATGAGTGTTGGCCAAGTATTGAACGAACACGATATTGATACGGAAAAAGAAGTATTGCTATGTGATACGGATAAAGCTATTCCAACGCCAATATATACAATATAA
hypothetical protein2666.3490430327.4-0.397368Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341333.5Heme, hemin uptake and utilization systems in GramPositives / Zn-dependent hydrolase YycJ/WalJ, required for cell wall metabolism and coordination of cell division with DNA replicationPF00753Lactamase_BMetallo-beta-lactamase superfamilyCL0381Metallo-HOrase81.1CytoplasmicIntracellularno predicted signal peptide088193845Q2G2U5YP_498630
MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTHEHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVESFNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCRYPWKTKQRILGDMGHVSNEDAAHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLNEHDIDTEKEVLLCDTDKAIPTPIYTI
no data available no polycistronic organisation predicted26224020; 26999783; 28887440
SAOUHSC_00025S. aureus NCTC8325SAUPAN000037000adsACDSSAOUHSC_00025hypothetical proteinchromosome+31005333232319no3919293YP_4986311288525
ATGAAAGCTTTATTACTTAAAACAAGTGTATGGCTCGTTTTGCTTTTTAGTGTAATGGGATTATGGCAAGTCTCGAACGCGGCTGAGCAGCATACACCAATGAAAGCACATGCAGTAACAACGATAGACAAAGCAACAACAGATAAGCAACAAGTACCGCCAACAAAGGAAGCGGCTCATCATTCTGGCAAAGAAGCGGCAACCAACGTATCAGCATCAGCGCAGGGAACAGCTGATGATACAAACAGCAAAGTAACATCCAACGCACCATCTAACAAACCATCTACAGTAGTTTCAACAAAAGTAAACGAAACACGCGACGTAGATACACAACAAGCCTCAACACAAAAACCAACTCACACAGCAACGTTCAAATTATCAAATGCTAAAACAGCATCACTTTCACCACGAATGTTTGCTGCTAATGCACCACAAACAACAACACATAAAATATTACATACAAATGATATCCATGGCCGACTAGCCGAAGAAAAAGGGCGTGTCATCGGTATGGCTAAATTAAAAACAGTAAAAGAACAAGAAAAGCCTGATTTAATGTTAGACGCAGGAGACGCCTTCCAAGGTTTACCACTTTCAAACCAGTCTAAAGGTGAAGAAATGGCTAAAGCAATGAATGCAGTAGGTTATGATGCTATGGCAGTCGGTAACCATGAATTTGACTTTGGATACGATCAGTTGAAAAAGTTAGAGGGTATGTTAGACTTCCCGATGCTAAGTACTAACGTTTATAAAGATGGAAAACGCGCGTTTAAGCCTTCAACGATTGTAACAAAAAATGGTATTCGTTATGGAATTATTGGTGTAACGACACCAGAAACAAAGACGAAAACAAGACCTGAAGGCATTAAAGGCGTTGAATTTAGAGATCCATTACAAAGTGTGACAGCGGAAATGATGCGTATTTATAAAGACGTAGATACATTTGTTGTTATATCACATTTAGGAATTGATCCTTCAACACAAGAAACATGGCGTGGTGATTACTTAGTGAAACAATTAAGTCAAAATCCACAATTGAAGAAACGTATTACAGTTATTGATGGTCATTCACATACAGTACTTCAAAATGGTCAAATTTATAACAATGATGCATTGGCACAAACAGGTACAGCACTTGCGAATATCGGTAAGATTACATTTAATTATCGCAATGGAGAGGTATCGAATATTAAACCGTCATTGATTAATGTTAAAGACGTTGAAAATGTAACACCGAACAAAGCATTAGCTGAACAAATTAATCAAGCTGATCAAACATTTAGAGCACAAACTGCAGAGGTAATTATTCCAAACAATACCATTGATTTCAAAGGAGAAAGAGATGACGTTAGAACGCGTGAAACAAATTTAGGAAACGCGATTGCAGATGCTATGGAAGCGTATGGCGTTAAGAATTTCTCTAAAAAGACTGACTTTGCCGTGACAAATGGTGGAGGTATTCGTGCCTCTATCGCAAAAGGTAAGGTGACACGCTATGATTTAATCTCAGTATTACCATTTGGAAATACGATTGCGCAAATTGATGTAAAAGGTTCAGACGTCTGGACGGCTTTCGAACATAGTTTAGGCGCACCAACAACACAAAAGGACGGTAAGACAGTGTTAACAGCGAATGGCGGTTTACTACATATCTCTGATTCAATCCGTGTTTACTATGATATAAATAAACCGTCTGGCAAACGAATTAATGCTATTCAAATTTTAAATAAAGAGACAGGTAAGTTTGAAAATATTGATTTAAAACGTGTATATCACGTAACGATGAATGACTTCACAGCATCAGGTGGCGACGGATATAGTATGTTCGGTGGTCCTAGAGAAGAAGGTATTTCATTAGATCAAGTACTAGCAAGTTATTTAAAAACAGCTAACTTAGCTAAGTATGATACGACAGAACCACAACGTATGTTATTAGGTAAACCAGCAGTAAGTGAACAACCAGCTAAAGGACAACAAGGTAGCAAAGGTAGTAAGTCTGGTAAAGATACACAACCAATTGGTGACGACAAAGTGATGGATCCAGCGAAAAAACCAGCTCCAGGTAAAGTTGTATTGTTGCTAGCGCATAGAGGAACTGTTAGTAGCGGTACAGAAGGTTCTGGTCGCACAATAGAAGGAGCTACTGTATCAAGCAAGAGTGGGAAACAATTGGCTAGAATGTCAGTGCCTAAAGGTAGCGCGCATGAGAAACAGTTACCAAAAACTGGAACTAATCAAAGTTCAAGCCCAGAAGCGATGTTTGTATTATTAGCAGGTATAGGTTTAATCGCGACTGTACGACGTAGAAAAGCTAGCTAA
hypothetical protein77210.049383424-0.480959MetabolismBiosynthesis of cofactors, prosthetic groups, and carriers; Transport and binding proteinsPyridine nucleotides; OtherNAD nucleotidaseTIGR01530134.4Nucleosides and Nucleotides / Purines / Purine conversions / 5'-nucleotidase (EC 3.1.3.5); Nucleosides and Nucleotides / Pyrimidines / pyrimidine conversions / 5'-nucleotidase (EC 3.1.3.5); Virulence, Disease and Defense / Adhesion / Adhesins in Staphylococcus / Virulence-associated cell-wall-anchored protein SasH (LPXTG motif)PF028725_nucleotid_C5'-nucleotidase, C-terminal domainno clan definedno clan defined141.4CellwallLPxTG Cell-wall anchoredsignal peptide predicted088193846Q2G253YP_498631
MKALLLKTSVWLVLLFSVMGLWQVSNAAEQHTPMKAHAVTTIDKATTDKQQVPPTKEAAHHSGKEAATNVSASAQGTADDTNSKVTSNAPSNKPSTVVSTKVNETRDVDTQQASTQKPTHTATFKLSNAKTASLSPRMFAANAPQTTTHKILHTNDIHGRLAEEKGRVIGMAKLKTVKEQEKPDLMLDAGDAFQGLPLSNQSKGEEMAKAMNAVGYDAMAVGNHEFDFGYDQLKKLEGMLDFPMLSTNVYKDGKRAFKPSTIVTKNGIRYGIIGVTTPETKTKTRPEGIKGVEFRDPLQSVTAEMMRIYKDVDTFVVISHLGIDPSTQETWRGDYLVKQLSQNPQLKKRITVIDGHSHTVLQNGQIYNNDALAQTGTALANIGKITFNYRNGEVSNIKPSLINVKDVENVTPNKALAEQINQADQTFRAQTAEVIIPNNTIDFKGERDDVRTRETNLGNAIADAMEAYGVKNFSKKTDFAVTNGGGIRASIAKGKVTRYDLISVLPFGNTIAQIDVKGSDVWTAFEHSLGAPTTQKDGKTVLTANGGLLHISDSIRVYYDINKPSGKRINAIQILNKETGKFENIDLKRVYHVTMNDFTASGGDGYSMFGGPREEGISLDQVLASYLKTANLAKYDTTEPQRMLLGKPAVSEQPAKGQQGSKGSKSGKDTQPIGDDKVMDPAKKPAPGKVVLLLAHRGTVSSGTEGSGRTIEGATVSSKSGKQLARMSVPKGSAHEKQLPKTGTNQSSSPEAMFVLLAGIGLIATVRRRKAS
no data available no polycistronic organisation predicted19808256; 22035583; 22088393; 26224020; 28887440
SAOUHSC_00026S. aureus NCTC8325SAUPAN000039000-CDSSAOUHSC_00026hypothetical proteinchromosome-3355534034480no3919294YP_4986321288526
TTGTGCAGGCCGTTTGATCCGCCAATGACGAAAACAAAGTCGCTTTGCCCTTGGGTCATGCGTTGGTTCAATTCTTGGGCCAATCCTTCGGAAGATAGCATCTTTCCTTGTATTTCTAATGTAATGACTGTGGATTGTGGTTTGATTTTGGCTAGTATTCGTTGGCCTTCTTTTTCTTTTACTTGCTCAATTTCTTTGTCACTCATATTTTCTGGTGCTTTTTCGTCTGGAACTTCTATGATGTCTATCTTGGTGTATGGGCCTAAACGTTTTTCATATTCTGCTATGGCTTGCTTCCAATATTTCTCTTTTAGTTTCCCTACAGCTAAAATGGTGATTTTCATGTCGTTTGGTCCTCCAAATTGTTATCAACTTTCCAGTTATCCACAAGTTATTAACTTGTTCACACTGTTCCCTCTTATTATACCAATATTTTTTGCAGTTTTTGATATTTTCCTGACATTTATGCCCGATTTTTAG
hypothetical protein1598.0208118108.30.614465FIG01107958: hypothetical proteinCytoplasmic MembraneMulti-transmembraneno predicted signal peptide388193847Q2G249YP_498632
MCRPFDPPMTKTKSLCPWVMRWFNSWANPSEDSIFPCISNVMTVDCGLILASIRWPSFSFTCSISLSLIFSGAFSSGTSMMSILVYGPKRFSYSAMACFQYFSFSFPTAKMVIFMSFGPPNCYQLSSYPQVINLFTLFPLIIPIFFAVFDIFLTFMPDF
no data available
SAOUHSC_00027S. aureus NCTC8325SAUPAN000040000orfXCDSSAOUHSC_0002723S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmHchromosome+3369134170480no3919295YP_4986331288527
ATGAAAATCACCATTTTAGCTGTAGGGAAACTAAAAGAGAAATATTGGAAGCAAGCCATAGCAGAATATGAAAAACGTTTAGGCCCATACACCAAGATAGACATCATAGAAGTTCCAGACGAAAAAGCACCAGAAAATATGAGTGACAAAGAAATTGAGCAAGTAAAAGAAAAAGAAGGCCAACGAATACTAGCCAAAATCAAACCACAATCCACAGTCATTACATTAGAAATACAAGGAAAGATGCTATCTTCCGAAGGATTGGCCCAAGAATTGAACCAACGCATGACCCAAGGGCAAAGCGACTTTGTTTTCGTCATTGGCGGATCAAACGGCCTGCACAAGGACGTCTTACAACGCAGTAACTACGCACTATCATTCAGCAAAATGACATTCCCACATCAAATGATGCGGGTTGTGTTAATTGAACAAGTGTACAGAGCATTTAAGATTATGCGAGGAGAGGCGTATCATAAGTAA
23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH1599.8588518306.2-0.4616352.1.1.177Genetic information processingProtein synthesistRNA and rRNA base modificationrRNA large subunit m3Psi methyltransferase RlmHTIGR00246186.6Ribosome biogenesis bacterial / 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase (EC 2.1.1.177)PF02590SPOUT_MTasePredicted SPOUT methyltransferaseCL0098SPOUT206.9CytoplasmicIntracellularno predicted signal peptide088193848Q2G252YP_498633
MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
no data available 10348769; 26224020; 28887440
SAOUHSC_00028S. aureus NCTC8325SAUPAN000830000-CDSSAOUHSC_00028hypothetical proteinchromosome-3437534509135no3919296YP_4986341288528
TTGAAACTTCATTGGTATATTTACTATTTTTTGTCAATATCTGTAATTTTATTTATGATTATTTATCATTACTTAGCTACGTCAATGACTGTTGATTATGAAATAACTGTTTCTATTGCAAAGTTACTTTTATAA
hypothetical protein447.666975321.431.14545PF15013CCSMST1CCSMST1 familyno clan definedno clan defined11.7Cytoplasmic MembraneN-terminally anchored (No CS)no predicted signal peptide188193849Q2G251YP_498634
MKLHWYIYYFLSISVILFMIIYHYLATSMTVDYEITVSIAKLLL
no data available
SAOUHSC_00029S. aureus NCTC8325SAUPAN000831000-CDSSAOUHSC_00029hypothetical proteinchromosome+344733456593no3919297YP_4986351288529
TTGACAAAAAATAGTAAATATACCAATGAAGTTTCAAAAGAACAATTCCAAGAAATTGAGAATGTAAATAATAAGGTCAAAGAATTTTATTAA
hypothetical protein306.695043670.04-1.41667ExtracellularIntracellularno predicted signal peptide088193850Q2G250YP_498635
MTKNSKYTNEVSKEQFQEIENVNNKVKEFY
no data available no polycistronic organisation predicted
SAOUHSC_00030S. aureus NCTC8325SAUPAN000832000-CDSSAOUHSC_00030hypothetical proteinchromosome+34712364571746no3919298YP_4986361288530
ATGAAGATTAATATTTATAAATCTATTTATAATTTTCAGGAAACAAATACAAATTTTTTAGAGAATCTAGAATCTTTAAATGATGACAATTATGAACTGCTTAATGATAAAGAACTTGTTAGTGATTCAAATGAATTAAAATTAATTAGTAAAGTTTATATACGTAAAAAAGACAAAAAACTATTAGATTGGCAATTATTAATAAAGAATGTATACCTAGATACTGAAGAAGATGACAATTTATTTTCAGAATCCGGTCATCATTTTGATGCAATATTATTTCTCAAAGAAGATACAACATTACAAAATAATGTATATATTATACCTTTTGGACAAGCATATCATGATATAAATAATTTGATTGATTATGACTTCGGAATTGATTTTGCAGAAAGAGCAATCAAAAATGAAGACATAGTTAATAAAAATGTTAATTTTTTTCAACAAAACAGGCTTAAAGAGATTGTTAATTATAGAAGGAATAGTGTAGATTACGTTAGACCTTCAGAATCTTATATATCAGTCCAAGGACATCCACAGAATCCTCAAATTTTTGGAAAAACAATGACTTGTGGTACAAGTATTTCATTGCGTGTACCGAATAGAAAGCAGCAATTCATAGATAAAATTAGTGTGATAATCAAAGAAATAAACGCTATTATTAATCTTCCTCAAAAAATTAGTGAATTTCCTAGAATAGTAACTTTAAAAGACTTGAATAAAATAGAAGTATTAGATACTTTATTGCTAAAAAAACTATCGAATTCTTCAACTACAGAAAATATATCTATAGATATATCAAGATTTTTAGAACTAAGTAATATGATACTCTTGTTAGATGATATGCTCGACGTCAATATATATATAAATTCTTTTAAAAATAATACATTAGAGACATTTGATGCGACTGATCCTGAAGTTGATTACATCACTGAAATAGGAGATTACTTATTAAAATATGACGTTAATTCTATAAATGATGTCAGAATTGAAGTGATAGATAATTTGGGGCATTCAAATAATATGCTACTAAAAACGATACTACATGCAGAAGTTGAAATGGAAGATGGAAAGAAATATTTATTACAAAATGGGAAATGGGGTTATTTTAATAGAGAATTTTTTGACCTTTTGAATGATCATTTGAATGAGATAGAAATTAGGTATAACACACTAACTCCCACAGGTTTAGTATTTAAAGAAGGAGAAGAAGGATATATAAAAGAAATAGTAGGAAGATTGCCAGAAGAATATTTAATGTTACATAAAAAATTCATAAAACCAATAAATAAGAATTTTATAGTAAAAGGAAATGGAATAGAGTTGGCAGACTTATACAATATTAAAAACAAAGAGCTTTTCACGATTAAAAGAGGAATTAATACATCTTTATCTCTTTATAGTCTAGAACAGAATATAATAGCAATTAACGCCTTAAAATATCCAGAATCATATAATTTTGAAGAATTAATAGAAGCTATTCCTGATAACTCGGAAAATATATTTAATGATATACAACGGAGTACAAATTTTAGTATAGTATGGATTTTACCGATATCATCTATTGATAATATGCCCATAAAAGATATGGTTCATACTAGTAACGTAATAAATAAAAACTTTCAATTAACTAATTTAGGTTCAGTATTACTTAAAAATAAATTAGTAGAGTGGTCTCTCTATTTAAAAGATCAAAGAATTAATCCAATTATTTATATGGAAACGCCAACTGAAGATAGAAATTAA
hypothetical protein5814.692267780.7-0.354733sporadically distributed protein, TIGR04141 familyTIGR0414190.6Arginine Biosynthesis extended / hypothetical proteinPF09101Exotox-A_bindExotoxin A bindingCL0004Concanavalin9.3CytoplasmicIntracellularno predicted signal peptide088193851Q2G2E9YP_498636
MKINIYKSIYNFQETNTNFLENLESLNDDNYELLNDKELVSDSNELKLISKVYIRKKDKKLLDWQLLIKNVYLDTEEDDNLFSESGHHFDAILFLKEDTTLQNNVYIIPFGQAYHDINNLIDYDFGIDFAERAIKNEDIVNKNVNFFQQNRLKEIVNYRRNSVDYVRPSESYISVQGHPQNPQIFGKTMTCGTSISLRVPNRKQQFIDKISVIIKEINAIINLPQKISEFPRIVTLKDLNKIEVLDTLLLKKLSNSSTTENISIDISRFLELSNMILLLDDMLDVNIYINSFKNNTLETFDATDPEVDYITEIGDYLLKYDVNSINDVRIEVIDNLGHSNNMLLKTILHAEVEMEDGKKYLLQNGKWGYFNREFFDLLNDHLNEIEIRYNTLTPTGLVFKEGEEGYIKEIVGRLPEEYLMLHKKFIKPINKNFIVKGNGIELADLYNIKNKELFTIKRGINTSLSLYSLEQNIIAINALKYPESYNFEELIEAIPDNSENIFNDIQRSTNFSIVWILPISSIDNMPIKDMVHTSNVINKNFQLTNLGSVLLKNKLVEWSLYLKDQRINPIIYMETPTEDRN
no data available no polycistronic organisation predicted26224020; 28887440
SAOUHSC_00031S. aureus NCTC8325SAUPAN000051000-CDSSAOUHSC_00031hypothetical proteinchromosome-3655137003453no3919299YP_4986371288531
ATGAGTAAAGTAGATGCACATTGGGAATTAATCGAAGCTATTAAAAATTTACGTGACGAAATTGCACCAAACACATTGTTAACAATTAACGATGATATTCCCGATAGAAAAACAGGACTTGAACTTGCAGAAAAATATGGTATTGATGGCATCATGATTGGTAGAGGCATTTTCCACAATCCATTCACTTTTGAAAAAGAACCACGCGAACACACAAGCAAAGAACTATTAGATTTGTTGAGATTGCATCTATCATTGTTTAACAAATATGAGAAAGATGAAATACGACAATTCAAGAGTTTGCGTAGATTCTTTAAAATCTATGTGCGTGGCATAAGAGGCGCTAGCGAACTTCGCCATCAATTGATGAACACACAATCAATTGCAGAAGTACGAGCACTACTAGATGAATTTGAAGCCCAAATGGACGAAGACGTTAAAATTGAATTATAG
hypothetical protein1505.6670617640.1-0.483333Unknown functionGeneralputative TIM-barrel protein, nifR3 familyTIGR0073746.9RNA Metabolism / RNA processing and modification / tRNA modification Archaea / tRNA dihydrouridine synthase B (EC 1.-.-.-)PF01207DusDihydrouridine synthase (Dus)CL0036TIM_barrel45.9CytoplasmicIntracellularno predicted signal peptide088193852Q2G2E8YP_498637
MSKVDAHWELIEAIKNLRDEIAPNTLLTINDDIPDRKTGLELAEKYGIDGIMIGRGIFHNPFTFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQLMNTQSIAEVRALLDEFEAQMDEDVKIEL
no data available no polycistronic organisation predicted26224020; 28887440
SAOUHSC_00032S. aureus NCTC8325SAUPAN000490000-CDSSAOUHSC_00032hypothetical proteinchromosome-3701937120102no3919300YP_4986381288532
TTGATGAAATATCCATATATGCTTATAAATATAAATTTATCAACTATAACTAAAAATGATAAAAGATTTAACGCCACTGATGACCGAATTAATATTATTTAA
hypothetical protein339.864353961.65-0.330303ExtracellularIntracellularno predicted signal peptide088193853Q2G2E6YP_498638
MMKYPYMLININLSTITKNDKRFNATDDRINII
no data available no polycistronic organisation predicted
SAOUHSC_00033S. aureus NCTC8325SAUPAN000489000tauECDSSAOUHSC_00033hypothetical proteinchromosome-3721837973756no3919301YP_4986391288533
ATGGATATTGTTAATATAGTTATCATGTTACTCATTGGGGTATTCGGTGGGTTCATATCTGGTCTAGTAGGCGTAGGTGGTGCTATCATTATTTATCCAGCTATTTTATTATTACCACCATTATTCGGAGCCCCTGCATATAGCGCATATATCGCATCAGGTCTTACTTCTAGCCAAGTCTTTTTCAGTACATTAAGTGGCTCATTAAAAGCTCGAAAAAAAACAGAGTTCTCGCCACAATTAGTTCTTTATATGGGTGGCGGCATGATTATAGGGAGTATGTTAGGTGCATTTCTAGCAAATTTATTTGATGCTACATTTGTAAATACGGTATATATCATTATTGCTTTACTTGCATTAACATTAATGTTTATTAAAGTGAAACCTAGTTCCGAAAAGTCTTCATTTAATAAATATTTATTAGTTATCATTGGCCTTTTCATTGGTATTATTTCAGGTATAGTAGGTGCAGGTGGTGCCTTCATTATTATTCCTATATTATTGGTTTTATTCAAATTACCAATGAATACTGTAGTCGCTAATAGTATAGTAATTGCTTTTATATCTTCAATTGGTGCTTTTGTCATCAAACTTATTCAAGGTTATATCCCTTTATATGACGCCTTATTCCTTATAATAGGGAGTATTATATTTGCTCCAATAGGGTTAAAATTAAGTAAAAAAGTCCCTAACATAATACAAAAATGGATTATCAGTATTTTAATCGTTTTTGCTATAGTTCAACTCATTTTATAA
hypothetical protein25110.298526690.61.3992FIG003846: hypothetical proteinPF01925TauESulfite exporter TauE/SafECL0292LysE140.8Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide788193854Q2G2E7YP_498639
MDIVNIVIMLLIGVFGGFISGLVGVGGAIIIYPAILLLPPLFGAPAYSAYIASGLTSSQVFFSTLSGSLKARKKTEFSPQLVLYMGGGMIIGSMLGAFLANLFDATFVNTVYIIIALLALTLMFIKVKPSSEKSSFNKYLLVIIGLFIGIISGIVGAGGAFIIIPILLVLFKLPMNTVVANSIVIAFISSIGAFVIKLIQGYIPLYDALFLIIGSIIFAPIGLKLSKKVPNIIQKWIISILIVFAIVQLIL
no data available no polycistronic organisation predicted26177047
SAOUHSC_00034S. aureus NCTC8325SAUPAN000488000cstRCDSSAOUHSC_00034hypothetical proteinchromosome-3797338233261no3919302YP_4986401288534
ATGAATTATGATAAAAAAATGATTAATCGTATTAATAGAATACAAGGGCAACTAAATGGAATTATTAAAATGATGGAGGAAGGAAAAGACTGTAAAGATGTCATTACACAAATAAGTGCATCAAAGAGTTCACTCCAACGCTTGATGGGTATCATTATTAGTGAGAATTTAATAGAATGTGTAAAAGCAGCTGCGGATGATGAAGAAAGCTCCCAAGAGTTAATTAATGAAGCTGTAAACTTATTGGTGAAAAGTAAGTAA
hypothetical protein865.124499641.17-0.293023FIG007303: uncharacterized proteinPF02583Trns_repr_metalMetal-sensitive transcriptional repressorno clan definedno clan defined87.7CytoplasmicIntracellularno predicted signal peptide088193855Q2G1R8YP_498640
MNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKSSLQRLMGIIISENLIECVKAAADDEESSQELINEAVNLLVKSK
no data available no polycistronic organisation predicted19570206; 25318663; 26177047; 26224020; 28887440
SAOUHSC_00035S. aureus NCTC8325SAUPAN000487000cstACDSSAOUHSC_00035hypothetical proteinchromosome+38370394371068no3919303YP_4986411288535
ATGAAACAATACGGAGAAAAGTTTATCGATGAATTTAGTAAAGCAGAATTGGAAAAACTAGCCAAGCAAGGGCAATTAATTGACGTTAGAACAGAAGAGGAGTATGCATTAGGACATATCAATGGTTCCATACTTCATCCTGTTGATGAGATTGAGTCATTCAATAAAGAAAAAAATAAAACCTATTATGTAATCTGTAGAAGTGGTAACAGAAGTGCTAATGCTAGTAAATATTTAGCTAAACAAGGTTATAACGTTATAAATCTTGATGGTGGTTATAAAGCTTATGAAGAAGAAAACGATAGTTATGATACACAAGAAGAATATAAAAGTATAGAAATTAAAGCAGATCGTAAACAATTTAACTATCGTGGTCTTCAATGTCCAGGGCCAATTGTAAAAATTAGTCAAGAAATGAAGAATATTGAAGTAGGTGACCAAATTGAAGTCAAAGTCACAGACCCTGGATTCCCTAGTGACATTAAAAGTTGGGTGAAACAAACAAGGCATACTTTAGTTAAGCTTGATGAAAATAACAATGGAATTAATGCGATTATTCAAAAAGAAAAAGCAAAAGATTTAGATATAAATTATTCTGCTAAAGGTACTACAATTGTATTATTTAGTGGAGAATTAGACAAAGCTGTAGCAGCGTTGATTATTGCAAATGGTGCTAGAGCTGCTGGAAAAGATGTAACTATCTTCTTTACTTTTTGGGGGCTTAATGCATTAAAAAAAGTGCAAACAGTTAATGTTAAAAAGCAAGGTATTGCAAAAATGTTTGATTTAATGTTGCCCAAAAAGAATATACGAATGCCTCTTTCCAAAATGAATATGTTTGGTTTAGGAAATATGATGATGCGCTACGTAATGAAAAAGAAAAATGTTGATTCATTACCAACACTTATCAATCAAGCTATTGAGCAAAATATCAAATTAATCGCTTGTACGATGAGTATGGATGTCATGGGTATTCAGAAAGAAGAACTTAGAGATGAAGTTGAGTACGGTGGTGTAGGCACTTATATTGGTGCTACTGAAAATGCGAATCATAATTTATTTATCTAA
hypothetical protein3558.3664640086.8-0.448169Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA 2-selenouridine synthaseTIGR0316736.7Disulfide bond regulatorPF13686DrsE_2DsrE/DsrF/DrsH-like familyCL0394DsrEFH-like195.4no significant predictionIntracellularno predicted signal peptide088193856Q2G1R7YP_498641
MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSILHPVDEIESFNKEKNKTYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAYEEENDSYDTQEEYKSIEIKADRKQFNYRGLQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKSWVKQTRHTLVKLDENNNGINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIANGARAAGKDVTIFFTFWGLNALKKVQTVNVKKQGIAKMFDLMLPKKNIRMPLSKMNMFGLGNMMMRYVMKKKNVDSLPTLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVGTYIGATENANHNLFI
no data available no polycistronic organisation predicted26177047; 26224020; 28887440
SAOUHSC_00036S. aureus NCTC8325SAUPAN000486000cstBCDSSAOUHSC_00036hypothetical proteinchromosome+39468408021335no3919304YP_4986421288536
ATGTTTTTTAAACAGTTTTACGATAATCATTTATCTCAAGCATCATATTTAGTGGGTTGTCAACGTACAGGAGAGGCAATAATAATAGACCCTGTTCGTGATTTATCGAAATATATAGAAGTTGCAGATTCTGAAGGTTTAACAATTACACAAGCTACAGAAACACATATTCATGCTGATTTTGCTTCAGGAATTCGTGATGTGGCTAAACGCTTAAATGCAAATATATATGTGTCTGGCGAAGGTGAAGATGCATTAGGGTATAAAAATATGCCATCAAAAACACAATTTGTTAAACATGGAGATATCATTCAAGTAGGCAATGTTAAATTAGAAGTTCTGCATACTCCAGGACACACGCCTGAAAGTATTAGCTTTTTACTCACTGATTTAGGTGGTGGTTCAAGTGTTCCGATGGGATTATTTAGTGGTGACTTTATTTTTGTTGGTGATATAGGTAGACCTGATTTATTAGAAAAATCTGTTCAAATAAAGGGTTCTACAGAAATTAGCGCGAAACAAATGTATGAGTCCGTTCAAAATATTAAAAATTTACCAGACTATGTTCAAATCTGGCCGGGTCATGGTGCTGGAAGCCCTTGTGGTAAAGCATTAGGTGCCATACCTATATCTACAATAGGTTATGAGAAAATTAATAACTGGGCATTTAATGAAATTGATGAGACTAAATTTATTGAATCATTAACATCAAATCAACCAGCACCACCGCATCATTTTGCACAAATGAAACAAGTTAATCAGTTTGGTATGAATTTATATCAATCATATGATGTTTATCCTAGTTTAGATAATAAGAGAGTAGCATTTGATCTTCGTAGCAAAGAGGCCTTTCACGGTGGCCACACAAAAGGAACAATCAATATACCATACAACAAAAACTTTATTAATCAAATTGGTTGGTACTTAGATTTTGAAAAAGATATAGATGTAATTGGAGATAAATCTACTGTTGAGAAAGCGAAACACACTTTACAATTAATTGGGTTTGATAAGGTAGCAGGCTATCGTTTGCCAAAATCAGGCATTTCAACCCAGTCCGTTCATAGCGCTGATATGACAGGTAAAGAAGAACATGTATTAGACGTACGTAATGATGAAGAGTGGAATAATGGACACTTAGATCAAGCAGTTAATATTCCGCATGGTAAATTATTAAATGAAAATATTCCTTTTAATAAAGAGGATAAAATATATGTACATTGTCAGTCAGGTGTTAGAAGTTCAATTGCAGTGGGTATATTGGAAAGCAAAGGTTTTGAAAATGTGGTGAATATTAGAGAAGGCTATCAAGATTTTCCAGAATCATTAAAATAA
hypothetical protein4445.9367449337.1-0.396396Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341378.1Zn-dependent hydroxyacylglutathione hydrolase / Polysulfide binding proteinPF00581RhodaneseRhodanese-like domainCL0031Phosphatase61.8CytoplasmicIntracellularno predicted signal peptide088193857Q2G1R6YP_498642
MFFKQFYDNHLSQASYLVGCQRTGEAIIIDPVRDLSKYIEVADSEGLTITQATETHIHADFASGIRDVAKRLNANIYVSGEGEDALGYKNMPSKTQFVKHGDIIQVGNVKLEVLHTPGHTPESISFLLTDLGGGSSVPMGLFSGDFIFVGDIGRPDLLEKSVQIKGSTEISAKQMYESVQNIKNLPDYVQIWPGHGAGSPCGKALGAIPISTIGYEKINNWAFNEIDETKFIESLTSNQPAPPHHFAQMKQVNQFGMNLYQSYDVYPSLDNKRVAFDLRSKEAFHGGHTKGTINIPYNKNFINQIGWYLDFEKDIDVIGDKSTVEKAKHTLQLIGFDKVAGYRLPKSGISTQSVHSADMTGKEEHVLDVRNDEEWNNGHLDQAVNIPHGKLLNENIPFNKEDKIYVHCQSGVRSSIAVGILESKGFENVVNIREGYQDFPESLK
no data available MicrobesOnline: SAOUHSC_00036 > SAOUHSC_0003726177047; 26224020; 28887440
SAOUHSC_00037S. aureus NCTC8325SAUPAN000838000sqrCDSSAOUHSC_00037hypothetical proteinchromosome+40821420141194no3919305YP_4986431288537
ATGAATAAGCATTATCAAATTGTTATTATTGGTGGCGGTACAGCAGGTGTTACCGTAGCATCAAGACTATTAAGAAAAAATCAAAACTTAAAAGAGAAAATAGCAATTATAGATCCAGCAGACCATCATTACTATCAACCATTATGGACGTTGGTTGGTGCAGGGGTATCTAGTTTGAAAAGTTCTCGTAAAGATATGGAAAGTGTTATACCTGAAGGTGCTAACTGGATAAAACAGGCTGTTTCAAGTTTTCAACCTGAAAATAATAGCGTTATTTTAGGAGATAATACAGTCGTTTATTATGATTTTTTAGTAGTAGCTCCAGGATTACAGATTAATTGGTCTTCAATTAAAGGACTAAAAGAAAATATAGGTAAAAATGGTGTTTGCTCTAACTATTCACCTGACTATGTTAACGAAACTTGGAACCAAATTTCTAATTTTAAACAAGGAAATGCCATTTTTACGCATCCAAACACTCCTATAAAGTGTGGAGGTGCGCCTATGAAAATTATGTATTTAGCTGAAGATTATTTTAGGAAACATAAAATCCGTTCTAACGCTAATGTGATATATGCAACGCCAAAAGATGCTTTATTTGACGTAGGAAAATATAATAAAGAATTAGAAAGGATTGTTGAAGAAAGAAATATAACAGTCAATTATAATTATAACCTTGTTGAAATCGACGGTGACAAAAAAGTGGCTACATTCGAACATATCAAAGCATACGATAGAAAAACAATAAGTTATGATATGTTACATGTAACACCACCTATGGGTCCCTTAGATGTAGTAAAAGAAAGTACACTTTCAGATAGTGAGGGTTGGGTAGATGTTAACCCAACCACATTACAGCATAAAAGCTACTCTAATGTATTTGCACTTGGTGATGCTTCAAATGTACCTACTTCAAAAACAGGCGCAGCTATTCGTAAGCAAGCACCTATCGTCGCTAATAATTTATTGCAAGTGATGAATAATCAAATGTTAACGCATCATTATGATGGTTATACTTCATGCCCTATTGTTACTGGATATAATAGGTTAATACTTGCAGAGTTTGATTATAATAAAAATACTAAAGAAACAATGCCGTTTAATCAGGCCAAAGAACGTAGAAGTATGTATATATTTAAGAAAGATTTATTACCTAAAATGTATTGGTACGGCATGCTAAAAGGATTAATATAA
hypothetical protein3979.2383744839.9-0.393199pyridine nucleotide-disulfide oxidoreductase family proteinTIGR0316960.8Sulfide:quinone oxidoreductase, Type IIPF07992Pyr_redox_2Pyridine nucleotide-disulphide oxidoreductaseCL0063NADP_Rossmann60no significant predictionIntracellularno predicted signal peptide088193858Q2G1R5YP_498643
MNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYYQPLWTLVGAGVSSLKSSRKDMESVIPEGANWIKQAVSSFQPENNSVILGDNTVVYYDFLVVAPGLQINWSSIKGLKENIGKNGVCSNYSPDYVNETWNQISNFKQGNAIFTHPNTPIKCGGAPMKIMYLAEDYFRKHKIRSNANVIYATPKDALFDVGKYNKELERIVEERNITVNYNYNLVEIDGDKKVATFEHIKAYDRKTISYDMLHVTPPMGPLDVVKESTLSDSEGWVDVNPTTLQHKSYSNVFALGDASNVPTSKTGAAIRKQAPIVANNLLQVMNNQMLTHHYDGYTSCPIVTGYNRLILAEFDYNKNTKETMPFNQAKERRSMYIFKKDLLPKMYWYGMLKGLI
no data available MicrobesOnline: SAOUHSC_00036 > SAOUHSC_00037SAOUHSC_0229815205410; 26177047; 26224020; 27035918; 28887440
SAOUHSC_00038S. aureus NCTC8325SAUPAN000751000-CDSSAOUHSC_00038hypothetical proteinchromosome-4228142382102no3919306YP_4986441288538
TTGAGTACACGTGGTTTGAATATCTGGCAAGAAATGGAAATTGGTAATGTCAGTCATAAAGTCGCTAAACGTGCTCAAATACCATTAATTATTTTTAAATAA
hypothetical protein3311.05853809.53-0.0545455Conserved domain proteinPF00582UspUniversal stress protein familyCL0039HUP15.8Cytoplasmic MembraneIntracellularno predicted signal peptide088193859Q2G1R4YP_498644
MSTRGLNIWQEMEIGNVSHKVAKRAQIPLIIFK
no data available no polycistronic organisation predicted
SAOUHSC_00039S. aureus NCTC8325SAUPAN000382000-CDSSAOUHSC_00039hypothetical proteinchromosome-4268143613933no3919307YP_4986451288539
ATGGAAGACGTTACAGATATCGTCTTTCGACACGTTGTAAGTGAAGCAGCTAGACCGGATGTGTTTTTCACTGAATTTACAAATACTGAAAGCTTTTGCCACCCTGAAGGCATACATAGTGTGCGCGGACGCTTAACTTTTAGTGAAGATGAACAGCCGATGGTCGCTCATATATGGGGAGATAAGCCAGAACAGTTCCGTGAAACGAGTATTCAATTAGCTAAAATGGGCTTTAAAGGCATAGACTTAAATATGGGATGTCCTGTAGCAAATGTTGCTAAAAAGGGTAAGGGTTCCGGCTTAATCTTAAGACCTGACGTTGCTGCCGAAATTATTCAAGCGACTAAAGCAGGTGGGCTTCCGGTAAGTGTTAAAACACGCCTTGGCTACTATGAAATCGATGAATGGAAAGATTGGTTGAAGCACGTCTTCGAACAAGACATTGCCAATTTATCTATTCATCTTCGTACACGTAAAGAAATGAGTAAAGTAGATGCACATTGGGAATTAATCGAAGCTATTAAAAATTTACGTGACGAAATTGCACCAAATACATTGTTAACAATTAACGGTGATATTCCCGATAGAAAAACAGGACTTGAACTGGCAGAAAAATATGGCATTGATGGCGTCATGATTGGTAGAGGCATTTTCCACAATCCATTCGCTTTTGAAAAAGAACCACGCGAACACACAAGCAAGGAACTATTAGATCTATTGAGATTGCATTTATCATTGTTTAACAAATATGAAAAAGATGAAATACGACAATTCAAGAGCTTGCGTAGATTCTTTAAAATCTATGTGCGTGGCATAAGAGGCGCTAGCGAACTTCGACATCAATTGATGAACACACAATCAATTGCAGAAGCACGAGCACTACTCGATGAATTTGAAGCCCAAATGGACGAAGACGTTAAAATTGAATTATAG
hypothetical protein3106.1466135562.5-0.3935481.3.1.-Unknown functionGeneralputative TIM-barrel protein, nifR3 familyTIGR00737152.5RNA Metabolism / RNA processing and modification / tRNA modification Archaea / tRNA dihydrouridine synthase B (EC 1.-.-.-)PF01207DusDihydrouridine synthase (Dus)CL0036TIM_barrel160.8CytoplasmicIntracellularno predicted signal peptide088193860Q2G1R3YP_498645
MEDVTDIVFRHVVSEAARPDVFFTEFTNTESFCHPEGIHSVRGRLTFSEDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLILRPDVAAEIIQATKAGGLPVSVKTRLGYYEIDEWKDWLKHVFEQDIANLSIHLRTRKEMSKVDAHWELIEAIKNLRDEIAPNTLLTINGDIPDRKTGLELAEKYGIDGVMIGRGIFHNPFAFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQLMNTQSIAEARALLDEFEAQMDEDVKIEL
no data available no polycistronic organisation predicted26224020; 28887440
SAOUHSC_00040S. aureus NCTC8325SAUPAN000383000-CDSSAOUHSC_00040hypothetical proteinchromosome+4397644179204no3919308YP_4986461288540
ATGGAAGGTTTAAAGCATTCTTTAAAAAGTTTAGGTTGGTGGGATTTATTTTTTGCGATACCTATTTTTCTGCTATTCGCATACCTTCCAAACTATAATTTTATAACTATATTTCTTAACATTGTTATCATTATTTTCTTTTCCATAGGTTTGATTTTAACTACGCATATAATTATAGATAAAATTAAGAGCAACACGAAATGA
hypothetical protein679.770087831.431.01343FIG01108234: hypothetical proteinPF11750DUF3307Protein of unknown function (DUF3307)no clan definedno clan defined11.3Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide288193861Q2G1R2YP_498646
MEGLKHSLKSLGWWDLFFAIPIFLLFAYLPNYNFITIFLNIVIIIFFSIGLILTTHIIIDKIKSNTK
no data available no polycistronic organisation predicted19570206
SAOUHSC_00041S. aureus NCTC8325SAUPAN000384000-CDSSAOUHSC_00041hypothetical proteinchromosome+4422844524297no3919309YP_4986471288541
ATGGCGACTAAGAAAGATGTACATGATTTATTTTTAAATCATGTGAATTCAAACGCGGTTAAGACAAGAAAGATGATGGGAGAATATATTATTTATTATGATGGCGTGGTTATAGGTGGTTTGTATGATAATAGATTATTGGTCAAGGCGACTAAAAGTGCCCAGCAGAAATTGCAAGATAATACATTAGTTTCGCCATATCCAGGTTCTAAAGAAATGATATTAATTCTAGACTTTACCGAAGCAACAAATCTCACTGATTTATTTAAGACCATAAAAAATGATTTGAAAAAGTGA
hypothetical protein989.6445211138.9-0.297959FIG01108183: hypothetical proteinPF04993TfoX_NTfoX N-terminal domainCL0631YgaC_TfoX-N37.4no significant predictionIntracellularno predicted signal peptide088193862Q2G1R1YP_498647
MATKKDVHDLFLNHVNSNAVKTRKMMGEYIIYYDGVVIGGLYDNRLLVKATKSAQQKLQDNTLVSPYPGSKEMILILDFTEATNLTDLFKTIKNDLKK
no data available no polycistronic organisation predicted26224020; 28887440
SAOUHSC_00042S. aureus NCTC8325SAUPAN000385000-CDSSAOUHSC_00042hypothetical proteinchromosome-44596458161221no3919310YP_4986481288542
ATGACTGATTTGTTGAAAATTAAAAACTTCAGATTGTTCTTTTTAGCAGAAATAATTTCAGCATTCGGAGTTGGAATTAGTACAGTTGGGGCTAATTGGTATTTAATCGACAAAACTAACGACTCCCAACTATTAGGTATTATGTTAGCTTTAAATGTATTATCCGGTTTCTTAGCTTCTCCTATAATAGGTGGACTAGCCGATAAATATAATAGACGAAATATTATTTTAATCACCTATCTTCTTCAGGTAATATTATATTTACTCATTGTCATAGCACTCGTAATGATAGGATTTGAGACCTATTTAGTGATTGGATTTGCGATTGTTAATGGGATAGGTTGGACTACGTATATGGCAACATCTAGAAGTTTAGTTAAACAGATATTAAAACCAGATCAATATACAGATGCAAATTCTCTATTAGAGATTAGTTTGCAAACAGGTATGTTTATTGCAGGTGGATTATCAGGAATATTATATAAAATAAATGGATTCACTCTAATTATAGCGATGACTATAATGATGTTTCTAATCAGCATTTTTATGTTATTTAGATTGCATGTAGATAAACCAACTCATTCAGAGGAAGAATCAACAAATAGCTTATTGCAAGAATATTTATTAGGATGGAAATTTTTAAAAGACAACATGATGATATTTATTTTTGGAGTTATTTCAATCATACCAATGGTGTTTACAATGATCTTTAACATATCATTACCAGGATATGTTTATAATGTTTTAAAACTTTCGTCTGTACAATTTGGTTTTTCAGATATGTTATATGGCATTGGAGGATTATGTGCAGGTTTAATTTCAGCTATTCTTTCGAAGAAAATCTCAACTAAAGTATTGATATTTTTGTTATATTTCATATTAGTCATAAATTCAGCACTATTTATTTGGATAAACTCAGCATTTTACTTATTCATAGGATCATTTATACTAGGCTACTCAATTTCATCAATCAGAATTTATATGAATACAGCTATAATGAACACTGTTTCAGATAAATATGTCGGTCGCTCATTTACGATATGGACGTCAATTTCATTGTTACTGCAAAGTTTAATTGCTCCATTTTTAGGAAGATGGATTAATGAAATTAATGATAAATTCGGTTTCTATATTATACTCATTTTATCCTTACTCATATTTGTTACACTGCTGCTTGTTAACAAAACAGACAAAATAAAATATGCACATAAAGAAGAGTGA
hypothetical protein4069.4375745716.50.86798MetabolismTransport and binding proteinsCations and iron carrying compoundsH+ Antiporter proteinTIGR00900165.1FIG01108443: hypothetical proteinPF07690MFS_1Major Facilitator SuperfamilyCL0015MFS109Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide1288193863Q2G1R0YP_498648
MTDLLKIKNFRLFFLAEIISAFGVGISTVGANWYLIDKTNDSQLLGIMLALNVLSGFLASPIIGGLADKYNRRNIILITYLLQVILYLLIVIALVMIGFETYLVIGFAIVNGIGWTTYMATSRSLVKQILKPDQYTDANSLLEISLQTGMFIAGGLSGILYKINGFTLIIAMTIMMFLISIFMLFRLHVDKPTHSEEESTNSLLQEYLLGWKFLKDNMMIFIFGVISIIPMVFTMIFNISLPGYVYNVLKLSSVQFGFSDMLYGIGGLCAGLISAILSKKISTKVLIFLLYFILVINSALFIWINSAFYLFIGSFILGYSISSIRIYMNTAIMNTVSDKYVGRSFTIWTSISLLLQSLIAPFLGRWINEINDKFGFYIILILSLLIFVTLLLVNKTDKIKYAHKEE
no data available MicrobesOnline: SAOUHSC_00042 < SAOUHSC_00043
SAOUHSC_00043S. aureus NCTC8325SAUPAN000386000-CDSSAOUHSC_00043hypothetical proteinchromosome-4580946360552no3919311YP_4986491288543
ATGATTACTTGTTTATTTGGAAGTAGTAGAAAAGATGGCAATTCAGCTATCGCAGTAGAGAATCTATTGAAGAATTTAAAAGTCAACTTTGTGAATTTATATCAAAGCAACATTGAAAAGGTTACAGATAATCGTCATAGCAAAGGTGCCAACTTTCATAATGATGATTACGAACAAATTTTAATCAAAGTTTTAGAATCAGATATTATTATTTTTTCAACACCACTCTATTGGTACTCCATGAGTGCGTCTTTAAAACTCTTCATTGATAGATGGACCGAGTCATTGCGAGATACGCAAATAGACAACTTCAAAGAAATCATGTCACAAAAAAAGTATTTGATTTTAATCATAGGTGGCGACAATCCGCATACCAAAGCACAACCTTTAGTCAACCAATTCAAATTAATATTTGAGTTTATGAATATTACTAACTATAGATTTTTGATCGGCGAAGGCAATAAACCATTCGATATTTTAAACGACTCTCAATTTATAGAAGAGCTCGCAAATATAAATCTTGCATTGAAAAAAGGTGATATTTATGACTGA
hypothetical protein1835.7228121196.1-0.231694MetabolismCentral intermediary metabolismSulfur metabolismFMN reductaseTIGR0356724.3Trp repressor binding proteinPF02525Flavodoxin_2Flavodoxin-like foldCL0042Flavoprotein62.5no significant predictionIntracellularno predicted signal peptide088193864Q2G1Q9YP_498649
MITCLFGSSRKDGNSAIAVENLLKNLKVNFVNLYQSNIEKVTDNRHSKGANFHNDDYEQILIKVLESDIIIFSTPLYWYSMSASLKLFIDRWTESLRDTQIDNFKEIMSQKKYLILIIGGDNPHTKAQPLVNQFKLIFEFMNITNYRFLIGEGNKPFDILNDSQFIEELANINLALKKGDIYD
no data available MicrobesOnline: SAOUHSC_00042 < SAOUHSC_0004326224020; 28887440
SAOUHSC_00044S. aureus NCTC8325SAUPAN000387000-CDSSAOUHSC_00044hypothetical proteinchromosome+4647347333861no3919077YP_4986501288544
TTGAACTTAAACATTTTAAAATCATTTTTAGTAACTAGTGAAACAAAGAACCTTACTAAAGCATCAGAGTTACTTAACTATTCACAGTCAACTGTATCTACACATATTGAAAAATTAGAAAGGCAATTAGATGTTAAATTATTTTATAGAAAAAAATATGGTATGGAACTAACGGAAGAAGGCTTAGCATACGTTAAATATGCTAAAGTGATTTTAGATAGTAATAGCGAATACGAGAGAGAAATAAAAGGACTTTACAATAAGAAGGTAAATATAAGTATTAACATGCAAGAAAGTCAGTATTTGTATCGCTACTATAATAAGATTAGTGAATGGTTAGCTGAACACCCATATGTAAACTTGAAGTTTAAATCCGCACATTCTAATTTCTATATTAAAGAAGAAATTGCTAATTTCAAATCGGATATTAGCCTTATCACAGACGAAAAGATTATTAATAGTAACTTAACTGCTATTCCTATAACTGAAGAACGTTTAATATTTGTTACTAACAAAGAGATGAAAGATTTCAAATTAAACGATATTCAAAACCATACATTACTTGTTACTGAAAAAGGGTGTAGTTACAGAGAACAGTTAGAAATGATTTTATATAAATATAGCTTTTCAACAAAACAAATGATTGAATTTCTAGGAATTGAGTCATTAAAAAAACACTTGAAAAATTCAGGTGGGATTGCGCTATTGCCGGAATTTATTGTTGCAGATGAATTAGAAAATAAAAGTTTGTTTCAAATAGACGTAGATGTCGATATTCCGAATTTAGAAACAACATTGATAATTAATCCTGAATCGAATAAGCAAGTACTTGAATCTTTTGTAAAAGATGTTTTTTTATAA
hypothetical protein2865.7674933410.2-0.331119Signal transductionRegulatory functionsDNA interactionsaminoethylphosphonate catabolism associated LysR family transcriptional regulatorTIGR0333982.8LysR-family regulatory proteinPF00126HTH_1Bacterial regulatory helix-turn-helix protein, lysR familyCL0123HTH60.8CytoplasmicIntracellularno predicted signal peptide088193865Q2G1Q8YP_498650
MNLNILKSFLVTSETKNLTKASELLNYSQSTVSTHIEKLERQLDVKLFYRKKYGMELTEEGLAYVKYAKVILDSNSEYEREIKGLYNKKVNISINMQESQYLYRYYNKISEWLAEHPYVNLKFKSAHSNFYIKEEIANFKSDISLITDEKIINSNLTAIPITEERLIFVTNKEMKDFKLNDIQNHTLLVTEKGCSYREQLEMILYKYSFSTKQMIEFLGIESLKKHLKNSGGIALLPEFIVADELENKSLFQIDVDVDIPNLETTLIINPESNKQVLESFVKDVFL
no data available 26224020; 28887440
SAOUHSC_00045S. aureus NCTC8325SAUPAN000846000-CDSSAOUHSC_00045hypothetical proteinchromosome-4768948222534no3919078YP_4986511288545
ATGCATGCAATGCAATATCATGTTAAGTTGCCTAGTGATTACAATATGGAAATAATTAGAGATAGAGTTCGATTAAATGGTTATAAGACTGATGGATTTAAAAATTTAATTATAAAAGCTTATTTAATAAGTCAAACAACTACTAATTGCATTACAAATACTTATTCACCATTATATTTATGGAGAAGTTCAGAGGGGATGACTGAATTTATATTCAATGGATTTTATGATAATGTTATTTCTTCTTTTGGATGGCAAAATATAAATATTGGTGTGATATATTCAATGAACATAACCGATTCTGTTAAACATAGTCTTTATGCGCTTGAAGAATATATCGACATTTTCCCTACTTTATCTCTAAAAGAAATAGAAATCAAAAAATTGTTTAGAATCTTCGATAATGCAGTTGCAGAAATTATAATTTATAATCCTGATAAGTGGAAGTTTGTGAAATATTCATTTATTGAAAATCTTCCAAAGAGTCTCAATCCAAATATAAAAATTTATGATGTACTATATATCTCACAATGA
hypothetical protein1777.5709620874.9-0.10678FIG01108949: hypothetical proteinPF16157DUF4865Domain of unknown function (DUF4865)no clan definedno clan defined203.4CytoplasmicIntracellularno predicted signal peptide088193866Q2G1Q7YP_498651
MHAMQYHVKLPSDYNMEIIRDRVRLNGYKTDGFKNLIIKAYLISQTTTNCITNTYSPLYLWRSSEGMTEFIFNGFYDNVISSFGWQNINIGVIYSMNITDSVKHSLYALEEYIDIFPTLSLKEIEIKKLFRIFDNAVAEIIIYNPDKWKFVKYSFIENLPKSLNPNIKIYDVLYISQ
no data available 26224020; 28887440
SAOUHSC_00046S. aureus NCTC8325SAUPAN000670000-CDSSAOUHSC_00046hypothetical proteinchromosome+4831349056744no3919079YP_4986521288546
GTGATTAAATTGAACTTTAATGATTTGGAAATTTTTATAACTGTATGTGAAGAAGCATCTATCAATAAAGCTGCAATTAAACTTAGATATGCACAATCTAATATATCTCAAAGAATTAGCAAGCTTGAAAATGAATTAGGTGTAGTTTTGCTTTTTAGAAATCAAAAAGGTGCTAAGGCAACTAAAGCAGGCGAAGAATTCTTAGCGTATAGCAAAAAAGTATTAAGAGATACAGAGACTATAAAAAATAAAATGAAAAATAATACTATGTCTATTTTATGCTCAGAACTGTTATTTAATTATTTATCTGAGAGCGAAGAAATTATGATGTCGAATAACTCAATTAATTTTATTTCTAGTGGAAATATTAGAAAAGCTATAGAAAAAAATAATTATGATAAGGTTATTTCATTCATAAAAATTAACGACTCAAATTATAGACTTAGTAATGTTGATACTATGAAAGTAACGCTTTACAGTAATGGAAGTAATTATGATAAAGAGGCTTTACTAATAAATAAAGATGAGTTTTGTCCTTTAAGGAAAATAACTTTAGATAATAAGCTTGATTCACAACGGGTAATGGAAATTGATTCATTGGCAGCAATAATAAACTTAGTTAAACAAGGAAAAGGAAAGGCTTTATTACCTATGACTTTTGAGAATAAAAGAGATATAGTACAGGACATTTCTAAGATATTTGAAGTTAACTACTATACTTATAATCATATTATGCATCATTAA
hypothetical protein2479.1893228421.6-0.3417Genetic information processing; Signal transduction; Cellular processesDNA metabolism; Regulatory functions; Cellular processesDNA replication, recombination, and repair; DNA interactions; Toxin production and resistancetranscriptional regulator, ArgP familyTIGR0329850.2LysR-family regulatory proteinPF00126HTH_1Bacterial regulatory helix-turn-helix protein, lysR familyCL0123HTH59.6CytoplasmicIntracellularno predicted signal peptide088193867Q2G1Q6YP_498652
MIKLNFNDLEIFITVCEEASINKAAIKLRYAQSNISQRISKLENELGVVLLFRNQKGAKATKAGEEFLAYSKKVLRDTETIKNKMKNNTMSILCSELLFNYLSESEEIMMSNNSINFISSGNIRKAIEKNNYDKVISFIKINDSNYRLSNVDTMKVTLYSNGSNYDKEALLINKDEFCPLRKITLDNKLDSQRVMEIDSLAAIINLVKQGKGKALLPMTFENKRDIVQDISKIFEVNYYTYNHIMHH
no data available no polycistronic organisation predicted26224020; 28887440
SAOUHSC_00047S. aureus NCTC8325SAUPAN000148000-CDSSAOUHSC_00047hypothetical proteinchromosome+4949050092603no3919080YP_4986531288547
ATGTTAATTAGTCTTGTAATCCCAGTTTTTGCTTTGTTAGTTATTGGTGGTATTATTTGGATGATTATAGAAGGTATAGTACATATTTCAAAAAAGAATAAAGCAATTGATAACTTTTTTAACCAAGTTAATAAAGTAAGTGAGACATATAAATTCGCTACTACTTTTTTATTTCTAATCTTGGCTACGGCTGGTATTTCTCAATTTTATCTATATTATATAGTATCAGCGTTTCTTTTTTGGCTTGTCATACTTACCTTTGGCATTGCAGGTATCATTTTTTTAATGCCATATGGATTATGTTTTCTACCGTTTTATAAGCAAAAAAAGAAAAAACAGACATTTAAAAAATACATGGTTTACACTACGATTGGTTTGTCAATTTGTCTAGGCTTATCTCTAGTTTTGGTTCACACTACGAAAATTTATATGGACGAAGGTGGCGTAAGATACTATTACGGTAGTTTTGTAATGAAACAAGCGGGCGGTTATGCTTATTTAGCTTTAGCGGTACTTTCAACGTTGTTAATTGTTGCGAAAAAAGCTACAAATAAAAATAAAGAAATCGAAACCGTCGACAATACAAATATAACGGAAAGATAA
hypothetical protein2009.9559522662.10.665integral membrane proteinTIGR0456112.7FIG01108477: hypothetical proteinPF05154TM2TM2 domainno clan definedno clan defined14.1Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide588193868Q2G1Q5YP_498653
MLISLVIPVFALLVIGGIIWMIIEGIVHISKKNKAIDNFFNQVNKVSETYKFATTFLFLILATAGISQFYLYYIVSAFLFWLVILTFGIAGIIFLMPYGLCFLPFYKQKKKKQTFKKYMVYTTIGLSICLGLSLVLVHTTKIYMDEGGVRYYYGSFVMKQAGGYAYLALAVLSTLLIVAKKATNKNKEIETVDNTNITER
no data available no polycistronic organisation predicted26224020; 28887440
SAOUHSC_00049S. aureus NCTC8325SAUPAN000849000-CDSSAOUHSC_00049hypothetical proteinchromosome+50359535113153no3919081YP_4986541288548
ATGAGTCAATTGCTAAATGATACGTTATCGGCTTGGTTGTTAATTGAATCTTTAAGTCCAGGAGAAGTAAATTTTACAGCGGAAGATATACTCTCAGCTGAACATTTTAAAAATGGTGCAAAGCAAGCACAACTTCAAAGTTTTGATGAATATTTTGAAATATGGAATGCTGAACGCTTTATTATATCAGAAGAAAAATCAGAGACTGGGGAACTTATATTTAAATTTTATAGACATTGCTTCCGCTATAATGAAATTAATTTGAAAATTCAGGATATTTTTGATGATTATTCTGAGATTCATAATCCAAATGGGACACACTGTTATGGTTACACATTTAACACAGATAAACACGGCAAAGTGATAGTTGATTCTATACATATTCCGATGATTATGAGTGCATTAAAAGAAATTGAAAAGAACAAAAATGCCAATATAGAAGAAAAATTTAATGATTCTGTTGAAAAATTTGTTCAAAAAGTAAAAGAAATTTTAGCAGATGAACCAATTAATGAATTTAAATTGAAGAAGATGGACAAAGCTTATGATGAGTACTTTTCTGTATTAAATTCAAAGAAAGATGGATTATTTGGACATTATGTAGCAATAGAATATGTGAAAGATAGTGATTTACCACAGCCGGAATTTAACAGCTTCTTCATAAGTGATATTGAGAAAGCAAGAAAATCTCCCAACCAAACTTTAATTGATTACATTGAAGGTGTAGAAGAAAGTCAGCGCATAGAAGTAGATGAAAATAAAGAAATGTTTGACAAATTTTTACATCCTTCACGTTTGCCTGATGGACGATGGCCATCACAGACTGAGTTTAGATTGTCTTTAATGCAACAACTTGCTGTAAACCAAATTACGAGTGGTAATGAAAGAATAAGTTCAGTTAATGGGCCACCAGGTACAGGTAAGACTACTTTATTAAAAGATATATTTGCTCATCTAGTAGTTGAAAGAGGTAAAGAGTTAGCTAAACTAAATAATCCTAAAGATGCATTTGTCAAAACAAAAATTCATGAAACGGATGATAAATACGTATACTTACTAAAGGAATCTATTGCCAAATATAAGATGGTAGTCGCATCTAGTAATAATGGAGCTGTTGAAAATATATCTAAAGATTTACCGAAAATTGAAGAAATTATAAGAAATCCCGAAAAATGTAAATTCCCTAAATATGAACAGAATTATGCAAATTTAGCACATGAATTAAAAGATTTTGCTGAAATAGCTGAAGATTTGATTGGTGAAAGTGCCTGGGGCTTATTTTCTGGAGTTTTTGGTAAAAGTACTAATATTAACCAAGTATTGAGTCATATGTTAAAACAAGATGCGAATGATATTGGCTTTGCTAAATTACTACAAAATGAGAATAATCGTATGAGTTATAACGAGTTAATGAGTGAATGGCAATCACATCAACGTGCATTTTTAGAAGAGTTGAGGCATGTTGAAATGTTAAAAGAAGAATCTATTAGAGCATATGATGTTTATAAAAATTGTGAGTCTTTCTCTAAGATTGAACAGGTTATTAATAGTGAAAAAACAAGTATTGAAGAACAGGTATATCATTTAGATAATGAAACGTTACGAGACAATAAAGAAATAGAAGATTTGGATAATCGAATTAATTATATTGTTAAGCAAATAGAAACTTTAAATGAGTTAATTAAATCCATCAAAGAAAGCAACAAAGGTTTTATTAACAAACTGAAAGCGATGTTTAATTCAGAAGAAGATGAAAGCTATAAAGATCATAATAAAGAGAAGCAACAATTATTAACACAACAGTTAGAGTTAGAGAAATGTAAAAAAAACAAACATGAAGACCTTGTTAGCAAACTAAAAGAAAAAGAGAAATTAATTAAACAATTAACTAAAGTACAGTTGCAATTAGACGAGTTAAATTCACAGTTACAAGAGTTAGAAGCATATCGTATTGAGTCAAAAATTACAATTCCAGAAAAAGATTTTTGGAGTGACAACAATTATGATGAGCGCCAAGTTACTAATCTGTGGACGAGTGACGAACTTCAATACAGACGTGCCATGCTCTTTTTAAGAGCAATGATATTGCATAAATTATTATTGATTGCTAATAATACAACTATTTATTATGCGATTAATGATTTTAAAGATAGAAGGAAATTAATTGATGCAAATCCAGATAAAGTACACAACGCATGGAATGTGATGCATTTAATATTTCCAGTAGTTAGTACGACGTTTGCAAGCTTTAAATCTATGTATGGGGGCATACCAAAAGATTTCATAGACTACTTATTTATTGATGAAGCAGGACAAGCAATACCTCAAGCAGCTGTGGGAGCATTATATCGTTCAAAAAAAGTTGTAGCTGTAGGTGATCCGATTCAAATAGAACCGGTTGTGACTTTAGAAAGTCATTTAATTGATAACATTCGTAAAAATTATCATGTTCCGGAATATCTAGTTTCTAAAGAAGCTTCTGTGCAGTCTGTTGCAGACAACGCCAATCAATATGGTTTTTGGAAATCTGATGCTACTGATAGTAATCAAAAAACCTGGATAGGCATACCTTTATGGGTGCACAGACGATGTTTAAAACCTATGTTCACGATAGCTAACCAAATCGCTTATAATAATAAAATGGTGTTGCCAAGTAATATTACAAAAGTAGGTAAAACAGGTTGGTATGACGTTAAAGGAAACGCAGTTCAAAAACAATTTGTGAAAGAGCATGGTGAAAAAGTAGTGGGATTATTAGCTGATGATTGGATTGAAGCAATTAAGGAAGGTAAAAATGAACCGAGCTCATTTGTAATATCGCCTTTTTCAGCAGTACAGCAACAGATTAAACGTATGTTAAAGCAACAACTACCGACTAGAATTGATATTGAACGTACAAAAATTAATCAATGGGTCGATAAATCCATTGGTACTGTTCATACTTTTCAAGGTAAAGAGGCTCAGAAGGTGTATTTTGTAATAGGTACTGATAATACCCAAGATGGTGCTGTGAACTGGTCATGCGAAAAACCAAACTTGTTAAACGTTGCAGTGACAAGAGCTAAGAAAGAGTTTTATGTAATTGGCGACATGCAAAGAATACAGATGAAACCATTTTATGAGACGATTTTTAAAGAAAGAAATGTAAAATAA
hypothetical protein10506.04559121729-0.569809Genetic information processingDNA metabolismDNA replication, recombination, and repairputative DNA helicaseTIGR0037637.5Superfamily I DNA/RNA helicase proteinPF01443Viral_helicase1Viral (Superfamily 1) RNA helicaseCL0023P-loop_NTPase56.7no significant predictionIntracellularno predicted signal peptide088193869Q2G1Q4YP_498654
MSQLLNDTLSAWLLIESLSPGEVNFTAEDILSAEHFKNGAKQAQLQSFDEYFEIWNAERFIISEEKSETGELIFKFYRHCFRYNEINLKIQDIFDDYSEIHNPNGTHCYGYTFNTDKHGKVIVDSIHIPMIMSALKEIEKNKNANIEEKFNDSVEKFVQKVKEILADEPINEFKLKKMDKAYDEYFSVLNSKKDGLFGHYVAIEYVKDSDLPQPEFNSFFISDIEKARKSPNQTLIDYIEGVEESQRIEVDENKEMFDKFLHPSRLPDGRWPSQTEFRLSLMQQLAVNQITSGNERISSVNGPPGTGKTTLLKDIFAHLVVERGKELAKLNNPKDAFVKTKIHETDDKYVYLLKESIAKYKMVVASSNNGAVENISKDLPKIEEIIRNPEKCKFPKYEQNYANLAHELKDFAEIAEDLIGESAWGLFSGVFGKSTNINQVLSHMLKQDANDIGFAKLLQNENNRMSYNELMSEWQSHQRAFLEELRHVEMLKEESIRAYDVYKNCESFSKIEQVINSEKTSIEEQVYHLDNETLRDNKEIEDLDNRINYIVKQIETLNELIKSIKESNKGFINKLKAMFNSEEDESYKDHNKEKQQLLTQQLELEKCKKNKHEDLVSKLKEKEKLIKQLTKVQLQLDELNSQLQELEAYRIESKITIPEKDFWSDNNYDERQVTNLWTSDELQYRRAMLFLRAMILHKLLLIANNTTIYYAINDFKDRRKLIDANPDKVHNAWNVMHLIFPVVSTTFASFKSMYGGIPKDFIDYLFIDEAGQAIPQAAVGALYRSKKVVAVGDPIQIEPVVTLESHLIDNIRKNYHVPEYLVSKEASVQSVADNANQYGFWKSDATDSNQKTWIGIPLWVHRRCLKPMFTIANQIAYNNKMVLPSNITKVGKTGWYDVKGNAVQKQFVKEHGEKVVGLLADDWIEAIKEGKNEPSSFVISPFSAVQQQIKRMLKQQLPTRIDIERTKINQWVDKSIGTVHTFQGKEAQKVYFVIGTDNTQDGAVNWSCEKPNLLNVAVTRAKKEFYVIGDMQRIQMKPFYETIFKERNVK
no data available no polycistronic organisation predicted26224020; 28887440
SAOUHSC_00050S. aureus NCTC8325SAUPAN000853000-CDSSAOUHSC_00050hypothetical proteinchromosome+5356854050483no3919082YP_4986551288549
ATGGAGAAATTTAACAACTGGATATTAAATGCAATAAGTGGATCTCAAACAGACAAGAATGAAACAACTGAAGAATTAAAAGGGGCAAAATTTATCATTTTATATGCATATTCAATGCTCGTTTTGCTTGCGTTAGTAATTTCTAACATATTCATTCACATTTTGGAGCCTAAACTATCAATCACCACTCAAATCATCATCGTTTTGATTTTAATTGAAGCACTAATTGGACTGCGTTTCTTGAAAGCGTACGATGTTAAGCGTGGCAAAGATAAAGAAAATAAGAAAAATAGTAAGGATTTCGTTAAACTAAAATCAATTTTAGTAGCAATTTTATTTACATCATTGGCGCTGACAGCAGGTACTGTAGCTGATATATACGGTTTCACTGACTTAGGAAATACTAGAAGTGATTTAATCGTTTGGAGCATAGGTGGTATTATATTTGGCCTCGTATGTTACACAATGGAAGATAAAAGATAA
hypothetical protein1609.3513817920.10.429375Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesoligosaccharide repeat unit polymeraseTIGR0437016.8FIG01108341: hypothetical proteinPF09323DUF1980Domain of unknown function (DUF1980)no clan definedno clan defined17.8Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide488193870Q2G1Q3YP_498655
MEKFNNWILNAISGSQTDKNETTEELKGAKFIILYAYSMLVLLALVISNIFIHILEPKLSITTQIIIVLILIEALIGLRFLKAYDVKRGKDKENKKNSKDFVKLKSILVAILFTSLALTAGTVADIYGFTDLGNTRSDLIVWSIGGIIFGLVCYTMEDKR
no data available no polycistronic organisation predicted26224020; 28887440
SAOUHSC_00051S. aureus NCTC8325SAUPAN000858000plcCDSSAOUHSC_000511-phosphatidylinositol phosphodiesterasechromosome+5425555241987no3919083YP_4986561288550
ATGAAAAAGTGTATTAAGACTTTGTTTTTAAGTATCATTTTAGTAGTGATGAGTGGTTGGTATCATTCAGCACATGCGTCAGATTCGTTGAGTAAAAGTCCAGAAAATTGGATGAGTAAACTTGATGATGGAAAACATTTAACTGAGATTAATATACCGGGTTCACATGATAGTGGCTCATTCACTTTAAAGGATCCAGTAAAATCAGTTTGGGCAAAGACTCAAGATAAAGATTACCTTACCCAAATGAAGTCGGGAGTCAGGTTTTTTGATATTAGAGGTAGAGCAAGTGCTGATAATATGATTTCAGTTCATCACGGCATGGTTTATTTGCATCATGAATTAGGAAAATTTCTCGATGATGCTAAATATTACTTGAGTGCTTATCCAAACGAAACAATTGTGATGTCTATGAAAAAGGACTACGATAGCGATTCTAAAGTTACGAAGACATTTGAAGAAATTTTTAGAGAATATTATTATAATAACCCGCAATATCAGAATCTTTTTTACACAGGAAGTAATGCGAATCCTACTTTAAAAGAAACGAAAGGTAAAATTGTCCTATTCAATAGAATGGGGGGTACGTACATAAAAAGTGGTTATGGTGCTGACACGTCAGGTATTCAATGGGCAGACAATGCGACATTTGAAACGAAAATTAATAATGGTAGCTTAAATTTAAAAGTACAAGATGAGTATAAAGATTACTATGATAAAAAAGTTGAAGCTGTTAAAAATTTATTGGCTAAAGCTAAAACGGATAGTAACAAAGACAATGTATATGTGAATTTCTTGAGTGTAGCGTCTGGAGGCAGCGCATTTAATAGTACTTATAACTATGCATCACATATAAATCCTGAAATTGCAAAAACGATTAAAGCAAATGGGAAAGCTAGAACGGGTTGGCTGATTGTTGACTATGCAGGATATACGTGGCCTGGATATGATGATATCGTAAGTGAAATTATAGATAGTAATAAATAA
1-phosphatidylinositol phosphodiesterase3288.6278537086.4-0.5554884.6.1.13Phages, Prophages, Transposable elements, Plasmids / Pathogenicity islands / Listeria Pathogenicity Island LIPI-1 extended / Phosphatidylinositol-specific phospholipase C (EC 4.6.1.13)PF00388PI-PLC-XPhosphatidylinositol-specific phospholipase C, X domainCL0384PLC65.7ExtracellularN-terminally anchored (No CS)signal peptide predicted188193871Q2G1Q2YP_498656
MKKCIKTLFLSIILVVMSGWYHSAHASDSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASHINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNK
no data available no polycistronic organisation predicted20472795; 26224020; 28887440
locus tagold locus tagnew locus tagorganismpan locus tagpan gene symboltypesymbolsynonymproductcommentrepliconstrandstartendgene lengthessentialGene IDgene RefSeqMicrobesOnlineDNAdescriptionprotein lengththeoretical pItheoretical MWGRAVYECTIGRFAM Meta RoleTIGRFAM Main RoleTIGRFAM Sub RoleTIGRFAM functionTIGRFAMTIGRFAM HMM scoreTheSEEDPFAM AccessionPFAMPFAM descriptionPFAM clan accessionPFAM clanPFAM HMM scoreeffectorinteraction partnersPSORTbLocatePSignalPtransmembrane helicesprotein GIUniProtprotein RefSeqprotein sequenceprotein peptides detectedprotein copies per celloperonregulatorpubmed
NWMN_0001NWMN_RS00005S. aureus NewmanSAUPAN000006000dnaACDSdnaAchromosomal replication initiation proteinchromosome+51718781362unknown5332606YP_0013310363705530
ATGTCGGAAAAAGAAATTTGGGAAAAAGTGCTTGAAATTGCTCAAGAAAAATTATCAGCTGTAAGTTACTCAACTTTCCTAAAAGATACTGAGCTTTACACGATTAAAGATGGTGAAGCTATCGTATTATCGAGTATTCCTTTTAATGCAAATTGGTTAAATCAACAATATGCTGAAATTATCCAAGCAATCTTATTTGATGTTGTAGGCTATGAAGTTAAACCTCACTTTATTACTACTGAAGAATTAGCAAATTATAGTAATAATGAAACTGCTACTCCAAAAGAAACAACAAAACCTTCTACTGAAACAACTGAGGATAATCATGTGCTTGGTAGAGAGCAATTCAATGCCCATAACACATTTGACACTTTTGTAATCGGACCCGGTAACCGCTTTCCACATGCAGCGAGTTTAGCTGTGGCCGAAGCACCAGCCAAAGCGTACAATCCATTATTTATCTATGGAGGTGTTGGTTTAGGAAAAACCCATTTAATGCATGCCATTGGTCATCATGTTTTAGATAATAATCCAGATGCCAAAGTGATTTACACATCAAGTGAAAAATTCACAAATGAATTTATTAAATCAATTCGTGATAACGAAGGTGAAGCTTTCAGAGAAAGATATCGTAATATCGACGTCTTATTAATCGATGATATTCAGTTCATACAAAACAAGGTACAAACACAAGAAGAATTTTTCTATACTTTTAATGAATTGCATCAGAATAACAAGCAAATAGTTATTTCGAGTGATCGACCACCAAAGGAAATTGCACAATTAGAAGACCGATTACGTTCACGCTTTGAATGGGGGCTAATTGTTGATATTACGCCACCAGATTATGAAACTCGAATGGCAATTTTGCAGAAGAAAATTGAAGAAGAAAAATTAGATATTCCACCAGAAGCTTTAAATTATATAGCAAATCAAATTCAATCTAATATTCGTGAATTAGAAGGTGCATTAACACGTTTACTTGCATATTCACAATTATTAGGAAAACCAATTACAACTGAATTAACTGCTGAAGCTTTAAAAGATATCATTCAAGCACCAAAATCTAAAAAGATTACCATCCAAGATATTCAAAAAATTGTAGGCCAGTACTATAATGTTAGAATTGAAGATTTCAGTGCAAAAAAACGTACAAAGTCAATTGCATATCCGCGTCAAATAGCTATGTACTTGTCTAGAGAGCTTACAGATTTCTCATTACCTAAAATTGGTGAAGAATTTGGTGGGCGTGATCATACGACCGTCATTCATGCTCATGAAAAAATATCTAAAGATTTAAAAGAAGATCCTATTTTTAAACAAGAAGTAGAGAATCTTGAAAAAGAAATAAGAAATGTATAA
chromosomal replication initiation protein4535.1162651965.3-0.488742Genetic information processingDNA metabolismDNA replication, recombination, and repairchromosomal replication initiator protein DnaATIGR00362594.7DNA Metabolism / DNA replication / DNA-replication / Chromosomal replication initiator protein DnaA; Cell Division Subsystem including YidCD / Chromosomal replication initiator protein DnaAPF00308Bac_DnaABacterial dnaA proteinCL0023P-loop_NTPase340.4CytoplasmicIntracellularno predicted signal peptide0151220213A6QD41YP_001331036
MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
no data available no polycistronic organisation predicted
NWMN_0002NWMN_RS00010S. aureus NewmanSAUPAN000007000dnaNCDSdnaNDNA polymerase III subunit betachromosome+216332961134unknown5331867YP_0013310373705531
ATGATGGAATTCACTATTAAAAGAGATTATTTTATTACACAATTAAATGACACATTAAAAGCTATTTCACCAAGAACAACATTACCTATATTAACTGGTATCAAAATCGATGCGAAAGAACATGAAGTTATATTAACTGGTTCAGACTCTGAAATTTCAATAGAAATCACTATTCCTAAAACTGTAGATGGCGAAGATATTGTCAATATTTCAGAAACAGGCTCAGTAGTACTTCCTGGACGATTCTTTGTTGATATTATAAAAAAATTACCTGGTAAAGATGTTAAATTATCTACAAATGAACAATTCCAGACATTAATTACATCAGGTCATTCTGAATTTAATTTAAGTGGCTTAGATCCAGATCAATATCCTTTATTACCTCAAGTTTCTAGAGATGACGCAATTCAATTGTCGGTAAAAGTGCTTAAAAACGTGATTGCACAAACAAATTTTGCAGTGTCCACCTCAGAAACACGCCCAGTACTAACTGGTGTGAACTGGCTTATACAAGAAAATGAATTAATATGCACAGCGACTGACTCACACCGCTTGGCTGTAAGAAAGTTGCAGTTAGAAGATGTTTCTGAAAACAAAAATGTCATCATTCCAGGTAAGGCTTTAGCTGAATTAAATAAAATTATGTCTGACAATGAAGAAGACATTGATATCTTCTTTGCTTCAAACCAAGTTTTATTTAAAGTTGGAAATGTGAACTTTATTTCTCGATTATTAGAAGGACATTATCCTGATACAACACGTTTATTCCCTGAAAACTATGAAATTAAATTAAGTATAGACAATGGGGAGTTTTATCATGCGATTGATCGTGCCTCTTTATTAGCGCGTGAAGGTGGTAATAACGTTATTAAATTAAGTACAGGTGATGACGTTGTTGAATTGTCTTCTACATCACCAGAAATTGGTACTGTAAAAGAAGAAGTTGATGCAAACGATGTTGAAGGTGGTAGCCTGAAAATTTCATTCAACTCTAAATATATGATGGATGCTTTAAAAGCAATCGATAATGATGAGGTTGAAGTTGAATTCTTCGGTACAATGAAACCATTTATTCTAAAACCAAAAGGTGACGACTCGGTAACGCAATTAATTTTACCAATCAGAACTTACTAA
DNA polymerase III subunit beta3774.4028441913.3-0.1615382.7.7.7Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, beta subunitTIGR00663375.1DNA Metabolism / DNA replication / DNA-replication / DNA polymerase III beta subunit (EC 2.7.7.7); Cell Division Subsystem including YidCD / DNA polymerase III beta subunit (EC 2.7.7.7)PF00712DNA_pol3_betaDNA polymerase III beta subunit, N-terminal domainCL0060DNA_clamp184CytoplasmicIntracellularno predicted signal peptide0151220214A0A0H3K645YP_001331037
MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIRTY
no data available no polycistronic organisation predicted
NWMN_0003NWMN_RS00020S. aureus NewmanSAUPAN000010000recFCDSrecFrecombination protein Fchromosome+391950311113unknown5331876YP_0013310383705532
ATGAAGTTAAATACACTCCAATTAGAAAATTATCGTAACTATGATGAGGTTACGTTGAAATGTCATCCTGACGTGAATATCCTCATTGGAGAAAATGCACAAGGAAAGACAAATTTACTTGAATCAATTTATACCTTAGCTTTAGCAAAAAGTCATAGAACGAGTAATGATAAGGAACTCATACGTTTTAATGCTGATTATGCTAAAATAGAAGGTGAGCTTAGTTATAGACACGGCACGATGCCATTAACAATGTTTATAACTAAAAAAGGTAAACAAGTCAAAGTGAATCACTTAGAGCAAAGTCGTCTAACTCAATATATTGGACACCTCAATGTGGTTCTATTTGCGCCAGAAGATTTGAATATTGTAAAAGGCTCTCCTCAAATAAGACGACGCTTTATAGATATGGAGTTGGGCCAAATTTCTGCTGTTTACTTAAATGATTTAGCTCAATACCAACGTATTTTAAAGCAAAAGAATAATTACTTAAAGCAGTTACAATTAGGCCAAAAAAAGGACTTAACAATGTTGGAAGTATTAAATCAGCAGTTTGCTGAATATGCAATGAAAGTAACTGATAAACGTGCACATTTTATTCAAGAGCTAGAGTCGTTAGCTAAACCGATTCATGCTGGTATCACAAATGATAAAGAAGCGTTGTCGCTGAATTATTTACCTAGTCTTAAATTTGATTATGCTCAAAATGAAGCGGCACGACTTGAAGAAATTATGTCTATTCTTAGCGATAATATGCAAAGAGAAAAAGAACGAGGCATTAGCTTATTCGGACCACATCGAGATGATATAAGTTTTGATGTGAATGGCATGGATGCTCAAACATATGGTTCTCAAGGACAGCAACGTACAACGGCTTTGTCCATTAAATTAGCTGAAATTGAGTTAATGAATATCGAAGTTGGGGAATATCCCATCTTATTATTAGACGATGTACTCAGTGAATTAGATGATTCGCGTCAAACGCATTTATTAAGTACGATTCAGCATAAAGTACAAACATTTGTCACTACGACATCTGTAGATGGTATTGATCATGAAATCATGAATAACGCTAAATTGTATCGTATTAATCAAGGTGAAATTATAAAGTAA
recombination protein F3706.4468842415.1-0.444054Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA replication and repair protein RecFTIGR00611474.6DNA Metabolism / DNA repair / DNA repair, bacterial RecFOR pathway / DNA recombination and repair protein RecF; Cell Division Subsystem including YidCD / DNA recombination and repair protein RecF; Hypothetical Coupled to RecF / DNA recombination and repair protein RecFPF02463SMC_NRecF/RecN/SMC N terminal domainCL0023P-loop_NTPase60.4
NWMN_0162; NWMN_0176; NWMN_0499; NWMN_0500; NWMN_0501; NWMN_0502; NWMN_0509; NWMN_0510; NWMN_0745; NWMN_0811; NWMN_0956; NWMN_0959; NWMN_0960; NWMN_0962; NWMN_1096; NWMN_1151; NWMN_1166; NWMN_1178; NWMN_1325; NWMN_1326; NWMN_1348; NWMN_1549; NWMN_1574; NWMN_1580; NWMN_1587; NWMN_1592; NWMN_1604; NWMN_1613; NWMN_1625; NWMN_1838; NWMN_1985; NWMN_2086; NWMN_2125; NWMN_2127; NWMN_2133; NWMN_2135; NWMN_2137; NWMN_2138; NWMN_2140; NWMN_2143; NWMN_2146; NWMN_2147; NWMN_2149; NWMN_2150; NWMN_2151; NWMN_2152; NWMN_2446; NWMN_2504
CytoplasmicIntracellularno predicted signal peptide0151220215A6QD43YP_001331038
MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKLYRINQGEIIK
no data available MicrobesOnline: NWMN_0003 > NWMN_0004 > NWMN_000521166474
NWMN_0004NWMN_RS00025S. aureus NewmanSAUPAN000011000gyrBCDSgyrBDNA gyrase B subunitchromosome+504169751935unknown5332339YP_0013310393705533
ATGGTGACTGCATTGTCAGATGTAAACAACACGGATAATTATGGTGCTGGGCAAATACAAGTATTAGAAGGTTTAGAAGCAGTACGTAAAAGACCAGGTATGTATATAGGATCGACTTCAGAGAGAGGTTTGCACCATTTAGTGTGGGAAATTGTCGATAATAGTATCGATGAAGCATTAGCTGGTTATGCAAATCAAATTGAAGTTGTTATTGAAAAAGATAACTGGATTAAAGTAACGGATAACGGACGTGGTATCCCAGTTGATATTCAAGAAAAAATGGGACGTCCAGCTGTCGAAGTTATTTTAACTGTTTTACATGCTGGTGGTAAATTTGGCGGTGGCGGATACAAAGTATCTGGTGGTTTACATGGTGTTGGTTCATCAGTTGTAAACGCATTGTCACAAGACTTAGAAGTATATGTACACAGAAATGAGACTATATATCATCAAGCATATAAAAAAGGTGTACCTCAATTTGACTTAAAAGAAGTTGGCACAACTGATAAGACAGGTACTGTCATTCGTTTTAAAGCAGATGGAGAAATCTTCACAGAGACAACTGTATACAACTATGAAACATTACAGCAGCGTATTAGAGAGCTTGCTTTCTTAAACAAAGGAATTCAAATCACATTAAGAGATGAACGTGATGAAGAAAACGTTAGAGAAGACTCCTATCACTATGAGGGCGGTATTAAATCGTACGTTGAGTTATTGAACGAAAATAAAGAACCTATTCATGATGAGCCAATTTATATTCATCAATCTAAAGATGATATTGAAGTAGAAATTGCGATTCAATATAACTCAGGATATGCCACAAATCTTTTAACTTACGCAAATAACATTCATACGTATGAAGGTGGTACGCATGAAGACGGATTCAAACGTGCATTAACGCGTGTCTTAAATAGTTATGGTTTAAGTAGCAAGATTATGAAAGAAGAAAAAGATAGACTTTCTGGTGAAGATACACGTGAAGGTATGACAGCAATTATATCTATCAAACATGGTGATCCTCAATTCGAAGGTCAAACGAAGACAAAATTAGGTAATTCTGAAGTGCGTCAAGTTGTAGATAAATTATTCTCAGAGCACTTTGAACGATTTTTATATGAAAATCCACAAGTCGCACGTACAGTGGTTGAAAAAGGTATTATGGCGGCACGTGCACGTGTTGCTGCGAAAAAAGCGCGTGAAGTAACACGTCGTAAATCAGCGTTAGATGTAGCAAGCCTTCCAGGTAAATTAGCCGATTGCTCTAGTAAAAGTCCTGAAGAATGTGAGATTTTCTTAGTCGAAGGGGACTCTGCCGGGGGGTCTACAAAATCTGGTCGTGACTCTAGAACGCAGGCGATTTTACCATTACGAGGTAAGATATTAAATGTTGAAAAAGCACGATTAGATAGAATTTTGAATAACAATGAAATTCGTCAAATGATCACAGCATTTGGTACAGGAATCGGTGGCGACTTTGATCTAGCGAAAGCAAGATATCACAAAATCGTCATTATGACTGATGCCGATGTGGATGGAGCGCATATTAGAACATTGTTATTAACATTCTTCTATCGATTTATGAGACCGTTAATTGAAGCAGGCTATGTGTATATTGCACAGCCACCGTTGTATAAACTGACACAAGGTAAACAAAAGTATTATGTATACAATGATAGGGAACTTGATAAACTTAAATCTGAATTGAATCCAACACCAAAATGGTCTATTGCACGATACAAAGGTCTTGGAGAAATGAATGCAGATCAATTATGGGAAACAACAATGAACCCTGAGCACCGCGCTCTTTTACAAGTAAAACTTGAAGATGCGATTGAAGCGGACCAAACATTTGAAATGTTAATGGGTGACGTTGTAGAAAACCGTAGACAATTTATAGAAGATAATGCAGTTTATGCAAACTTAGACTTCTAA
DNA gyrase B subunit6445.6814572539.3-0.4899075.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, B subunitTIGR01059994DNA Metabolism / DNA replication / DNA topoisomerases, Type II, ATP-dependent / DNA gyrase subunit B (EC 5.99.1.3); Virulence, Disease and Defense / Resistance to antibiotics and toxic compounds / Resistance to fluoroquinolones / DNA gyrase subunit B (EC 5.99.1.3); Cell Division Subsystem including YidCD / DNA gyrase subunit B (EC 5.99.1.3)PF00204DNA_gyraseBDNA gyrase BCL0329S5211.1
NWMN_0005; NWMN_0509; NWMN_1178; NWMN_1592
CytoplasmicIntracellularno predicted signal peptide0151220216A0A0H3KD61YP_001331039
MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
no data available MicrobesOnline: NWMN_0003 > NWMN_0004 > NWMN_000521166474
NWMN_0005NWMN_RS00030S. aureus NewmanSAUPAN000012000gyrACDSgyrADNA gyrase A subunitchromosome+699496752682unknown5331984YP_0013310403705534
TTGAAGGAGGAACTCTTGATGGCTGAATTACCTCAATCAAGAATAAATGAACGAAATATTACCAGTGAAATGCGTGAATCATTTTTAGATTATGCGATGAGTGTTATCGTTGCTCGTGCATTGCCAGATGTTCGTGACGGTTTAAAACCAGTACATCGTCGTATACTATATGGATTAAATGAACAAGGTATGACACCGGATAAATCATATAAAAAATCAGCACGTATCGTTGGTGACGTAATGGGTAAATATCACCCTCATGGTGACTCATCTATTTATGAAGCAATGGTACGTATGGCTCAAGATTTCAGTTATCGTTATCCGCTTGTTGATGGCCAAGGTAACTTTGGTTCAATGGATGGAGATGGCGCAGCAGCAATGCGTTATACTGAAGCGCGTATGACTAAAATCACACTTGAACTGTTACGTGATATTAATAAAGATACAATAGATTTTATCGATAACTATGATGGTAATGAAAGAGAGCCGTCAGTCTTACCTGCTCGATTCCCTAACTTATTAGCCAATGGTGCATCAGGTATCGCGGTAGGTATGGCAACGAATATTCCACCACATAACTTAACAGAATTAATCAATGGTGTACTTAGCTTAAGTAAGAACCCTGATATTTCAATTGCTGAGTTAATGGAGGATATTGAAGGTCCTGATTTCCCAACTGCTGGACTTATTTTAGGTAAGAGTGGTATTAGACGTGCATATGAAACAGGTCGTGGTTCAATTCAAATGCGTTCTCGTGCAGTTATTGAAGAACGTGGAGGCGGACGTCAACGTATTGTTGTCACTGAAATTCCTTTCCAAGTGAATAAGGCTCGTATGATTGAAAAAATTGCAGAGCTCGTTCGTGACAAGAAAATTGACGGTATCACTGATTTACGTGATGAAACAAGTTTACGTACTGGTGTGCGTGTCGTTATTGATGTGCGTAAGGATGCAAATGCTAGTGTCATTTTAAATAACTTATACAAACAAACACCTCTTCAAACATCATTTGGTGTGAATATGATTGCACTTGTAAATGGTAGACCGAAGCTTATTAATTTAAAAGAAGCGTTGGTACATTATTTAGAGCATCAAAAGACAGTTGTTAGAAGACGTACGCAATACAACTTACGTAAAGCTAAAGATCGTGCCCACATTTTAGAAGGATTACGTATCGCACTTGACCATATCGATGAAATTATTTCAACGATTCGTGAGTCAGATACAGATAAAGTTGCAATGGAAAGCTTGCAACAACGCTTCAAACTTTCTGAAAAACAAGCTCAAGCTATTTTAGACATGCGTTTAAGACGTCTAACAGGTTTAGAGAGAGACAAAATTGAAGCTGAATATAATGAGTTATTAAATTATATTAGTGAATTAGAAGCAATCTTAGCTGATGAAGAAGTGTTATTACAGTTAGTTAGAGATGAATTGACTGAAATTAGAGATCGTTTCGGTGATGATCGTCGTACAGAAATTCAATTAGGTGGATTTGAAAACTTAGAGGACGAAGACTTAATTCCAGAAGAACAAATAGTAATTACACTAAGCCATAATAACTACATTAAACGTTTGCCGGTATCTACATATCGTGCTCAAAACCGTGGTGGTCGTGGTGTTCAAGGTATGAATACATTGGAAGAAGATTTTGTCAGTCAATTGGTAACTTTAAGTACACATGACCATGTATTGTTCTTTACTAACAAAGGTCGTGTATACAAACTTAAAGGTTACGAAGTGCCTGAGTTATCAAGACAGTCTAAAGGTATTCCTGTAGTGAATGCTATTGAACTTGAAAATGATGAAGTCATTAGTACAATGATTGCTGTTAAAGACCTTGAAAGTGAAGACAACTTCTTAGTGTTTGCAACTAAACGTGGTGTCGTTAAACGTTCAGCATTAAGTAACTTCTCAAGAATAAATAGAAATGGTAAGATTGCGATTTCGTTCAGAGAAGATGATGAGTTAATTGCAGTTCGCTTAACAAGTGGTCAAGAAGATATCTTGATTGGTACATCACATGCATCATTAATTCGATTCCCTGAATCAACATTACGTCCTTTAGGCCGTACAGCAACGGGTGTGAAAGGTATTACACTTCGTGAAGGTGACGAAGTTGTAGGGCTTGATGTAGCTCATGCAAACAGTGTTGATGAAGTATTAGTAGTTACTGAAAATGGTTATGGTAAACGTACGCCAGTTAATGACTATCGCTTATCAAATCGTGGTGGTAAAGGTATTAAAACAGCTACGATTACTGAGCGTAATGGTAATGTTGTATGTATCACTACAGTAACTGGTGAAGAAGATTTAATGATTGTTACTAATGCAGGTGTCATTATTCGACTAGATGTTGCAGATATTTCTCAAAATGGTCGTGCAGCACAAGGTGTTCGCTTAATTCGCTTAGGTGATGATCAATTTGTTTCAACGGTTGCTAAAGTAAAAGAAGATGCAGAAGATGAAACGAATGAAGATGAGCAATCTACTTCAACTGTATCTGAAGATGGTACTGAACAACAACGTGAAGCGGTTGTAAATGATGAAACACCAGGAAATGCAATTCATACTGAAGTGATTGATTCAGAAGAAAATGATGAAGATGGACGTATTGAAGTAAGACAAGATTTCATGGATCGTGTTGAAGAAGATATACAACAATCATCAGATGAAGAATAA
DNA gyrase A subunit8934.78271100093-0.4477045.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, A subunitTIGR010631210.8DNA Metabolism / DNA replication / DNA topoisomerases, Type II, ATP-dependent / DNA gyrase subunit A (EC 5.99.1.3); Virulence, Disease and Defense / Resistance to antibiotics and toxic compounds / Resistance to fluoroquinolones / DNA gyrase subunit A (EC 5.99.1.3); Cell Division Subsystem including YidCD / DNA gyrase subunit A (EC 5.99.1.3)PF00521DNA_topoisoIVDNA gyrase/topoisomerase IV, subunit Ano clan definedno clan defined529.8
NWMN_1325
CytoplasmicIntracellularno predicted signal peptide0151220217A0A0H3K5G6YP_001331040
MKEELLMAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELEAILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLGGFENLEDEDLIPEEQIVITLSHNNYIKRLPVSTYRAQNRGGRGVQGMNTLEEDFVSQLVTLSTHDHVLFFTNKGRVYKLKGYEVPELSRQSKGIPVVNAIELENDEVISTMIAVKDLESEDNFLVFATKRGVVKRSALSNFSRINRNGKIAISFREDDELIAVRLTSGQEDILIGTSHASLIRFPESTLRPLGRTATGVKGITLREGDEVVGLDVAHANSVDEVLVVTENGYGKRTPVNDYRLSNRGGKGIKTATITERNGNVVCITTVTGEEDLMIVTNAGVIIRLDVADISQNGRAAQGVRLIRLGDDQFVSTVAKVKEDAEDETNEDEQSTSTVSEDGTEQQREAVVNDETPGNAIHTEVIDSEENDEDGRIEVRQDFMDRVEEDIQQSSDEE
no data available MicrobesOnline: NWMN_0003 > NWMN_0004 > NWMN_000521166474
NWMN_0006NWMN_RS00035S. aureus NewmanSAUPAN000013000nnrDCDSNWMN_0006hypothetical proteinchromosome-976210592831unknown5331983YP_0013310413705535
ATGGGAGGTTATATCACTATGGAAACGTTAAATTCTATTAACATTCCTAAGCGTAAAGAAGATTCACATAAAGGTGATTATGGCAAAATTTTATTAATTGGTGGATCTGCTAACTTAGGTGGTGCCATTATGTTAGCGGCTCGTGCATGTGTATTTAGCGGTAGTGGTTTAATCACTGTAGCTACACATCCAACAAATCATTCAGCATTACATTCTCGTTGCCCAGAAGCGATGGTTATTGATATTAATGATACGAAAATGTTGACGAAAATGATTGAAATGACTGACAGTATACTAATTGGTCCAGGTCTTGGCGTTGATTTCAAAGGAAATAATGCCATTACATTCCTACTACAAAATATACAACCGCATCAAAATTTAATCGTAGACGGCGATGCGATTACAATCTTTAGTAAACTGAAACCGCAATTACCTACATGTCGTGTGATCTTTACACCACACCTCAAAGAATGGGAACGATTAAGTGGTATTCCTATTGAGGAACAGACATATGAGCGTAATCGTGAAGCAGTTGATCGTTTAGGTGCAACTGTTGTACTTAAAAAACATGGTACTGAAATTTTCTTTAAAGATGAAGACTTTAAATTGACAATCGGTAGCCCAGCAATGGCGACTGGTGGTATGGGCGATACACTTGCTGGTATGATTACAAGCTTTGTCGGTCAATTTGATAACTTAAAAGAAGCGGTTATGAGTGCCACATATACACATAGTTTTATTGGCGAAAACCTTGCAAAAGATATGTATGTGGTGCCACCATCAAGACTTATCAATGAAATACCTTACGCAATGAAACAATTAGAAAGTTAG
hypothetical protein2766.5121530171.7-0.03840584.2.1.136Unknown functionGeneralYjeF family C-terminal domainTIGR00196185.4ADP-dependent (S)-NAD(P)H-hydrate dehydratase (EC 4.2.1.136)PF01256Carb_kinaseCarbohydrate kinaseCL0118Ribokinase194.4no significant predictionIntracellularno predicted signal peptide0151220218A0A0H3K5Z7YP_001331041
MGGYITMETLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIMLAARACVFSGSGLITVATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQNIQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDRLGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSATYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
no data available
NWMN_0007NWMN_RS00040S. aureus NewmanSAUPAN000014000hutHCDShutHhistidine ammonia-lyasechromosome+10900124141515unknown5329920YP_0013310423705536
ATGACTTTATATTTAGATGGTGAAACACTAACAATTGAGGATATTAAATCATTTTTACAACAACAATCAAAGATTGAAATTATTGATGATGCGTTAGAACGTGTCAAAAAAAGTAGAGCGGTAGTTGAACGTATTATTGAAAATGAGGAAACGGTTTACGGTATTACTACAGGTTTTGGGTTATTTAGTGATGTACGTATAGACCCGACGCAATATAATGAATTACAAGTGAATCTGATACGCTCACATGCCTGTGGACTAGGTGAGCCATTTTCAAAAGAAGTAGCATTAGTCATGATGATTTTACGATTGAATACATTATTAAAAGGTCATTCAGGTGCCACTTTAGAATTAGTGAGACAATTACAATTTTTTATAAATGAACGTATTATACCGATAATCCCACAGCAAGGCTCTCTCGGTGCATCAGGAGATTTAGCGCCATTATCACATTTAGCATTAGCATTAATTGGTGAAGGGAAAGTATTGTACAGAGGGGAAGAAAAGGATAGTGACGATGTATTAAGAGAATTAAATAGACAACCTTTGAACCTTCAGGCTAAAGAAGGTTTAGCATTGATTAATGGTACGCAAGCTATGACAGCTCAAGGTGTCATTAGTTATATAGAAGCAGAAGATTTAGGTTACCAATCTGAATGGATTGCTGCATTAACGCATCAGTCTCTTAATGGCATTATAGATGCATATCGACATGATGTGCACGCAGTTCGTAATTTTCAAGAACAGATTAATGTGGCAGCGCGTATGCGTGATTGGTTAGAAGGATCAACATTAACGACGCGACAATCAGAAATACGTGTACAAGATGCATATACGTTGCGTTGTATACCACAAATCCATGGCGCGAGTTTTCAAGTATTCAATTATGTTAAACAGCAATTAGAATTTGAAATGAATGCGGCTAATGATAATCCACTTATATTTGAGGAAGCAAATGAAACGTTTGTTATTTCAGGTGGTAACTTCCATGGACAACCTATTGCTTTTGCATTAGATCATCTTAAATTAGGTGTAAGTGAATTAGCAAACGTATCGGAACGTCGTCTAGAGCGACTAGTAAATCCTCAATTAAATGGTGATTTACCAGCATTTCTTAGTCCAGAGCCAGGATTGCAAAGTGGCGCGATGATTATGCAATATGCTGCTGCAAGTCTCGTTTCTGAAAATAAAACTTTAGCGCATCCAGCGAGTGTTGATTCTATCACTTCATCTGCGAACCAAGAAGATCACGTATCTATGGGAACTACAGCTGCTAGACATGGTTATCAAATTATTGAAAATGCAAGACGTGTGCTGGCAATCGAATGTGTTATTGCATTACAAGCAGCAGAGTTAAAAGGTGTTGAAGGATTATCACCAAAAACACGTCGCAAGTATGATGAGTTTCGAAGTATCGTGCCATCCATTACACATGATCGTCAATTTCATAAAGATATTGAAGCGGTTGCACAGTATTTAAAGCAATCAATTTATCAAACGACTGCATGTCACTAA
histidine ammonia-lyase5045.1467156075.2-0.1857144.3.1.3MetabolismEnergy metabolismAmino acids and amineshistidine ammonia-lyaseTIGR01225665Amino Acids and Derivatives / Histidine Metabolism / Histidine Degradation / Histidine ammonia-lyase (EC 4.3.1.3)PF00221Lyase_aromaticAromatic amino acid lyaseno clan definedno clan defined612.4CytoplasmicIntracellularno predicted signal peptide0151220219A6QD47YP_001331042
MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERIIENEETVYGITTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRLNTLLKGHSGATLELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVLYRGEEKDSDDVLRELNRQPLNLQAKEGLALINGTQAMTAQGVISYIEAEDLGYQSEWIAALTHQSLNGIIDAYRHDVHAVRNFQEQINVAARMRDWLEGSTLTTRQSEIRVQDAYTLRCIPQIHGASFQVFNYVKQQLEFEMNAANDNPLIFEEANETFVISGGNFHGQPIAFALDHLKLGVSELANVSERRLERLVNPQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTLAHPASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKGVEGLSPKTRRKYDEFRSIVPSITHDRQFHKDIEAVAQYLKQSIYQTTACH
no data available no polycistronic organisation predictedNWMN_1629 *1
NWMN_0008NWMN_RS00045S. aureus NewmanSAUPAN000017000serSCDSserSseryl-tRNA synthetasechromosome+12793140791287unknown5332025YP_0013310433705537
ATGTTAGACATTAGATTATTCAGAAATGAGCCTGACACAGTTAAGAGCAAAATTGAATTACGTGGAGATGATCCAAAAGTTGTAGATGAAATTTTAGAATTGGATGAGCAACGACGTAAATTAATTAGTGCAACAGAAGAAATGAAAGCACGTCGTAATAAAGTAAGCGAAGAAATCGCATTAAAAAAACGTAATAAAGAAAATGCTGATGATGTGATTGCTGAAATGCGCACATTAGGTGACGATATTAAAGAAAAAGATAGTCAATTAAATGAAATTGATAATAAAATGACAGGTATCCTTTGTCGTATTCCAAATTTAATAAGTGATGATGTACCTCAAGGTGAATCTGATGAAGATAACGTTGAAGTTAAAAAGTGGGGTACACCACGTGAGTTTTCATTTGAACCCAAAGCACATTGGGATATTGTAGAAGAATTGAAAATGGCTGATTTTGATCGTGCAGCAAAAGTTTCAGGTGCGCGTTTTGTATATTTAACAAATGAAGGTGCGCAATTAGAGCGTGCTTTAATGAACTATATGATTACAAAACATACAACACAACATGGTTATACAGAAATGATGGTACCACAGCTTGTGAACGCAGATACAATGTATGGTACAGGTCAATTACCTAAATTTGAAGAAGATTTATTTAAAGTAGAAAAAGAAGGATTATATACAATTCCAACTGCTGAAGTACCATTAACGAATTTCTACCGTAATGAAATTATTCAACCAGGTGTACTTCCTGAAAAATTCACTGGTCAATCTGCATGTTTCCGTAGTGAAGCAGGATCAGCAGGTAGAGATACAAGAGGATTAATTCGTTTACATCAATTCGATAAAGTGGAAATGGTACGTTTTGAACAACCTGAAGATTCATGGAATGCTTTAGAAGAAATGACAACAAACGCAGAAGCAATTCTAGAAGAGTTAGGTTTACCATACCGTCGTGTTATTTTATGTACAGGTGATATTGGATTTAGTGCAAGCAAAACATATGATTTAGAAGTTTGGTTACCAAGCTACAATGATTATAAAGAAATTAGTTCATGCTCAAACTGTACGGATTTCCAAGCGCGTCGTGCTAACATCCGCTTCAAGCGTGACAAAGCAGCTAAACCAGAATTAGCACATACATTAAATGGTAGTGGTTTAGCAGTTGGACGTACATTTGCTGCTATTGTTGAAAATTACCAAAATGAAGATGGAACAGTAACAATTCCAGAAGCATTAGTACCATTTATGGGTGGTAAAACACAAATTTCAAAACCAGTTAAATAA
seryl-tRNA synthetase4284.7466548639.7-0.5866826.1.1.11Genetic information processingProtein synthesistRNA aminoacylationserine--tRNA ligaseTIGR00414571.6Amino Acids and Derivatives / Alanine, serine, and glycine / Glycine and Serine Utilization / Seryl-tRNA synthetase (EC 6.1.1.11); Protein Metabolism / Protein biosynthesis / tRNA aminoacylation, Ser / Seryl-tRNA synthetase (EC 6.1.1.11)PF00587tRNA-synt_2btRNA synthetase class II core domain (G, H, P, S and T)CL0040tRNA_synt_II114.8
NWMN_0509; NWMN_0510; NWMN_0741; NWMN_0959; NWMN_0960; NWMN_0961; NWMN_0962; NWMN_1166; NWMN_1326; NWMN_1483; NWMN_1569; NWMN_1592; NWMN_1600; NWMN_2086; NWMN_2149; NWMN_2534
CytoplasmicIntracellularno predicted signal peptide0151220220A6QD48YP_001331043
MLDIRLFRNEPDTVKSKIELRGDDPKVVDEILELDEQRRKLISATEEMKARRNKVSEEIALKKRNKENADDVIAEMRTLGDDIKEKDSQLNEIDNKMTGILCRIPNLISDDVPQGESDEDNVEVKKWGTPREFSFEPKAHWDIVEELKMADFDRAAKVSGARFVYLTNEGAQLERALMNYMITKHTTQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVEKEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRDTRGLIRLHQFDKVEMVRFEQPEDSWNALEEMTTNAEAILEELGLPYRRVILCTGDIGFSASKTYDLEVWLPSYNDYKEISSCSNCTDFQARRANIRFKRDKAAKPELAHTLNGSGLAVGRTFAAIVENYQNEDGTVTIPEALVPFMGGKTQISKPVK
no data available no polycistronic organisation predicted21166474
NWMN_0009NWMN_RS00050S. aureus NewmanSAUPAN000018000-CDSNWMN_0009hypothetical proteinchromosome+1472915424696unknown5332473YP_0013310443705538
ATGACAACACATTTAAGTTTTAGACAAGGCGTGCAAGAGTGTATCCTAACATTATTGGGTTATGCCGGTGTTGGTATTTCATTTGGTATTGTGGCTTCGTCTCAAAACTTTAGTATTTTAGAAATTGTCTTGTTATGTCTTGTTATATATGCCGGTGCTGCGCAATTTATTATGTGCGCGTTGTTTATAGCAGGTACACCTATATCAGCGATTGTACTAACTGTATTTATCGTAAATTCAAGAATGTTCCTTTTAAGTATGTCGCTTGCACCAAACTTCAAGACATATGGGTTTTGGAACCGTGTTGGATTAGGTTCATTAGTAACTGACGAAACGTTTGGCGTCGCCATTACACCTTATTTAAAAGGAGAAGCTATCAATGATCGTTGGATGCATGGTCTTAACATCACAGCATATTTATTTTGGGCAATTTCATGTGTAGCTGGGGCTTTATTTGGCGAATATATCTCAAATCCGCAAACGCTAGGGTTAGATTTTGCTATCACGGCTATGTTTATCTTTTTGGCCATTGCGCAATTTGAATCAATTACTAAATCGCGATTAAGAATTTACATAGTACTCATTATTGCCGTCATAGTAATGATGTTATCGCTAAGTATGTTTATGCCTTCATATCTAGCAATATTAATTGCAGCCACAATTTCAGCAGCGTTAGGAGTGATGATGGAACAATGA
hypothetical protein2316.49023251631.07186MetabolismTransport and binding proteinsAmino acids, peptides and aminesazaleucine resistance protein AzlCTIGR0034685.5Branched-chain amino acid permeasePF03591AzlCAzlC proteinno clan definedno clan defined126.3Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide7151220221A0A0H3K9T1YP_001331044
MTTHLSFRQGVQECILTLLGYAGVGISFGIVASSQNFSILEIVLLCLVIYAGAAQFIMCALFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPYLKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQFESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMEQ
no data available MicrobesOnline: NWMN_0009 > NWMN_0010
NWMN_0010NWMN_RS00055S. aureus NewmanSAUPAN000019000-CDSNWMN_0010hypothetical proteinchromosome+1542115750330unknown5329921YP_0013310453705539
ATGATAACTCATATGAACATGTTAATACTTATTTTATTGTGTGGTATCGTAACGCTATTAATTCGAATTATACCTTTTATCATGATTTCAAAAGTGCAATTGCCTGATGTCGTGGTTCGATGGCTATCATTTATCCCAATCACACTATTTACAGCACTTGTCATTGACAGCATTATTCAACAGACGCCTCATGGTGAGGGGTATACATTAAACATCCCTTACATTATCGCGCTCATTCCGACGGTTATTTTATCTATAATCACGCGTAGTTTAACTATTACAATTATTAGTGGGATTGTTATCATGGCAGCATTACGATTTTTCTTTTAA
hypothetical protein1099.2996112233.11.47523Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein FTIGR021209.3FIG01107951: hypothetical proteinPF05437AzlDBranched-chain amino acid transport protein (AzlD)no clan definedno clan defined83.4Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide4151220222A0A0H3K650YP_001331045
MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQQTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAALRFFF
no data available MicrobesOnline: NWMN_0009 > NWMN_0010
NWMN_0011NWMN_RS00060S. aureus NewmanSAUPAN000021000metXCDSNWMN_0011hypothetical proteinchromosome+1611317081969unknown5329922YP_0013310463705540
ATGACAAATTACACAGTAGATACTTTAAATTTAGGGGAATTTATTACAGAATCTGGGGAAGTCATAGATAACTTGCGTTTGAGATATGAGCATGTCGGTTATCATGGACAACCATTAGTTGTAGTTTGTCATGCATTAACTGGCAATCATTTAACATATGGAACAGATGATTATCCGGGTTGGTGGCGAGAAATTATTGATGGGGGATATATACCCATTCACGATTATCAATTTTTAACATTTGATGTTATTGGTAGTCCTTTCGGTTCAAGTTCACCTTTAAACGACCCTCATTTTCCTAAAAAATTAACATTAAGAGATATAGTCAGAGCGAATGAACGAGGTATACAAGCCCTTGGTTATGATAAGATTAATATTTTAATAGGGGGAAGTCTTGGAGGTATGCAAGCAATGGAACTACTCTACAATCAACAGTTTGAAGTAGATAAAGCCATTATCCTTGCTGCAACAAGTCGAACATCATCTTATAGTAGAGCTTTCAATGAAATTGCAAGGCAAGCCATTCATCTTGGTGGTAAGGAAGGTCTAAGTATTGCACGCCAATTAGGTTTTTTGACATATCGATCATCAAAAAGTTATGATGAACGTTTCACGCCGGATGAAGTAGTCGCATACCAACAACATCAAGGTAATAAATTTAAAGAACATTTTGATTTGAATTGTTATCTGACACTGCTAGATGTATTGGATAGTCACAACATTGACCGAGGTCGCACAGACGTAACGCATGTTTTTAAAAATTTAGAAACAAAAGTGTTAACGATGGGGTTCATAGATGATTTGCTATATCCGGATGATCAAGTTCGTGCATTAGGTGAACGTTTTAAATATCATCGTCATTTCTTCGTGCCTGATAATGTTGGGCATGATGGATTCCTACTAAACTTTAGTACCTGGGCACCTAACTTATATCATTTCTTAAATTTAAAGCATTTTAAGCGTAAGTAA
hypothetical protein3226.614736927.4-0.349068MetabolismAmino acid biosynthesisAspartate familyhomoserine O-acetyltransferaseTIGR01392202Amino Acids and Derivatives / Lysine, threonine, methionine, and cysteine / Methionine Biosynthesis / Homoserine O-acetyltransferase (EC 2.3.1.31)PF00561Abhydrolase_1alpha/beta hydrolase foldCL0028AB_hydrolase59.4CytoplasmicIntracellularno predicted signal peptide0151220223A0A0H3KD65YP_001331046
MTNYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRK
no data available no polycistronic organisation predictedNWMN_1165 *1
NWMN_0012NWMN_RS00065S. aureus NewmanSAUPAN000023000-CDSNWMN_0012hypothetical proteinchromosome+1732418310987unknown5329923YP_0013310473705541
TTGTTAATTTTCATTAAAGAGGTTAAAATAATAGCTATAGTTAAAAATATGGGAGTGGCTTATGTGTTTTCAAAAATACAACCTAAAGCAACAATAATTGCAACGATTGCGTTGGTATTTGTCGCTTTAGCTTTATATCTAGTGCCTGGTTTAGGACTAATATTTGCATTATTTGCAACCATACCAGGTATCGTTTTATGGAATAAATCAATACAATCTTTCGGGATTAGTGCACTTATTACAGTAATTATAACAACTGTTTTAGGTAATACTTTCGTTTTAAGTGCCATCATATTAGTCTTAATTGCAAGTTTAATTATTGGTCAATTGCTCAAAGAAAGAACGTCTAAAGAAAGAATATTATACGTAACAACAGTAGCGATGAGCTTAATTTCATTAATCGCTTTTATGTTACTACAAACATTCGGAAGGATTCCACCATCAGCGAGCATAGTAAAACCTTTCAAGCAAACATTACATGAAGCGATTACGATGAGCGGTGCCGATGCGAATATGACCCAAATATTAGAAGAAGGGTTTAGACAAGCGACCGTTCAATTACCAGGTTTCATCATTATCATTACATTTTTAATCGTCTTAATTAACTTAATCGTTACATTTCCGATTTTACGAAAATTTAAAATCGCTACACCTGTATTTAAGCCACTTTTCGCGTGGCAAATGAGCGGTATTTTATTATGGATATACATTATTGTTATCATATGTTTATTATTTACAGGTCAACCGAGTGTGTTCCAGAGCATTCTTTTAAACTTCCAACTTGTGTTATCATTAGTAATGTATATTCAAGGTTTAAGTGTTATTCATTTCTTTGGTAAAGCGAAAGGTTTGCCGAATGCAGTAACGATTTTACTATTGGTTATCGGTACAATACTGACACCTACGACACATATTGTAGGACTACTTGGTGTTATCGATTTAAGTTTGAATTTGAAGCGAATCATGAAAAATAATTCTAAAAAGTGA
hypothetical protein32810.896536002.91.15823CBSS-262719.3.peg.410 / FIG003573: hypothetical proteinPF09991DUF2232Predicted membrane protein (DUF2232)no clan definedno clan defined212.5Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide7151220224A0A0H3K5H0YP_001331047
MLIFIKEVKIIAIVKNMGVAYVFSKIQPKATIIATIALVFVALALYLVPGLGLIFALFATIPGIVLWNKSIQSFGISALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSKERILYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILEEGFRQATVQLPGFIIIITFLIVLINLIVTFPILRKFKIATPVFKPLFAWQMSGILLWIYIIVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLVIGTILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
no data available MicrobesOnline: NWMN_0012 > NWMN_0013 > NWMN_0014 > NWMN_0015
NWMN_0013NWMN_RS00070S. aureus NewmanSAUPAN000024000-CDSNWMN_0013hypothetical proteinchromosome+18325202921968unknown5329924YP_0013310483705542
ATGAATCGGCAGTCCACTAAGAAAGCTTTACTAATACCATTTGTCATCATGATCATCACAGCAATTGTTTTAATGGGTGTATGGTTTATCTTTAATAGTCTTATAGCACTAATTGCATCTATCGTTCTTGTCGTGATGATTATTGTTAGCATCATTTTATTCAGACAAGCTTTAATGAAAATGGATAGTTATGTAGATGGTTTGAGTGCTCAAATTTCAACAACAAATAATAAAGCAATCAAACATTTACCAATTGGTATCATTGTTTTAGATGAAAATGATCACATCGAATGGGTTAACCAATTTATGACAGATCATATGGAAGCGAATGTCATTTCTGAATCTGTAAATGAAGTATTTCCAAACATTTTAAAGCAATTAGATAGAGTGAAATCCGTTGAAATAGAATATAATCAGTATCATTTCCAAGTACGTTATTCTGAGAATGATCACTGCCTCTATTTCTTTGATATAACTGAACAAGTACAAACAAATGAACTATATGAAAATTCTAAACCAATCATTGCGACATTATTTTTAGATAACTACGATGAGATTACGCAAAATATGAATGATACGCAGCGTTCGGAAATCAACTCAATGGTAACGCGTGTCATTAGTCGATGGGCAACTGAGTATAATATATTTTTCAAAAGATACAGTTCCGATCAATTCGTAGCCTATTTAAATCAAAAAATATTAGCTGACTTAGAAGAATCTAAATTTGATATCTTGAGTCAATTACGTGAAAAAAGTGTTGGTTATCGTGCCCAATTAACATTAAGTATCGGTGTTGGTGAAGGTACTGAAAATTTAATCGACTTAGGTGAATTATCACAATCAGGCCTAGACTTAGCATTAGGACGCGGTGGCGACCAAGTTGCAATTAAAAGTATTAATGGTAATGTGCGTTTCTATGGCGGTAAGACTGACCCGATGGAGAAACGTACTCGTGTAAGAGCACGTGTGATCTCACATGCGTTAAAAGATATCCTTGCAGAGGGTGACAAAGTCATTATCATGGGACATAAACGTCCTGACTTAGATGCAATTGGTGCAGCAATCGGTGTGTCTAGATTTGCAATGATGAATAATTTAGAAGCATACATCGTATTAAATGAGACTGACATTGATCCAACATTACGACGCGTGATGAACGAAATAGATAAAAAGCCAGAGTTAAGAGAGCGATTTATTACATCAGATGATGCTTGGGATATGATGACATCTAAGACAACCGTAGTGATTGTTGATACGCATAAACCGGAACTGGTTTTAGATGAAAATGTCTTAAATAAAGCAAACCGTAAAGTTGTTATCGATCATCATAGACGTGGTGAAAGCTTCATCTCTAATCCATTGTTGATATATATGGAACCATACGCAAGTTCGACAGCTGAATTGGTAACAGAGTTACTGGAATATCAACCAACAGAACAACGTTTAACACGTCTTGAATCAACAGTGATGTATGCAGGTATTATTGTAGATACAAGAAACTTTACATTACGAACAGGATCAAGAACATTCGATGCAGCGAGTTATTTACGTGCACATGGTGCAGATACGATTTTAACGCAACATTTCTTAAAAGATGATGTGGATACTTACATTAATCGATCTGAATTAATTCGAACTGTAAAAGTTGAAGATAATGGCATAGCCATTGCGCATGGTTCAGACGATAAAATTTATCATCCAGTAACAGTTGCACAAGCAGCAGATGAACTGTTAAGTTTAGAAGGTATTGAAGCATCATATGTTGTTGCGAGACGTGAAGATAATCTGATTGGTATATCTGCGCGTTCACTCGGTTCAGTAAATGTCCAGTTAACAATGGAAGCACTTGGTGGCGGTGGACATTTAACCAATGCGGCAACACAACTTAAAGGTGTGACAGTCGAAGAGGCGATAGCACAATTACAACAAGCAATTACAGAACAATTAAGTAGGAGTGAAGATGCATGA
hypothetical protein6554.9008373780.7-0.110229Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR0296617.5CBSS-262719.3.peg.410 / Phosphoesterase, DHH family proteinPF01368DHHDHH familyCL0137HAD79.2CytoplasmicMulti-transmembraneno predicted signal peptide2151220225A0A0H3K601YP_001331048
MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMKMDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTDHMEANVISESVNEVFPNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFLDNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEESKFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSINGNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRFAMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFITSDDAWDMMTSKTTVVIVDTHKPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQRLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINRSELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGISARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
no data available MicrobesOnline: NWMN_0012 > NWMN_0013 > NWMN_0014 > NWMN_0015
NWMN_0014NWMN_RS00075S. aureus NewmanSAUPAN000025000rplICDSrplI50S ribosomal protein L9chromosome+2028920735447unknown5329925YP_0013310493705543
ATGAAAGTAATTTTTACACAAGATGTTAAAGGTAAAGGTAAAAAAGGTGAAGTTAAAGAAGTACCAGTAGGTTATGCAAATAACTTCTTATTGAAAAAGAATTATGCTGTAGAAGCAACACCAGGTAACCTTAAACAATTAGAGTTACAGAAAAAACGTGCAAAACAAGAACGCCAACAAGAAATTGAAGATGCTAAAGCATTAAAAGAAACGTTATCAAACATTGAAGTTGAAGTATCAGCAAAAACTGGTGAAGGTGGTAAATTGTTTGGGTCAGTAAGTACAAAACAAATTGCCGAAGCACTAAAAGCACAACATGATATTAAAATTGATAAACGTAAAATGGATTTACCAAATGGAATTCATTCCCTAGGATATACGAATGTACCTGTTAAATTAGATAAAGAAGTTGAAGGTACAATTCGCGTACACACAGTTGAACAATAA
50S ribosomal protein L914810.065416453.8-0.681757Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL9TIGR00158149.7Protein Metabolism / Protein biosynthesis / Ribosome LSU bacterial / LSU ribosomal protein L9p; CBSS-262719.3.peg.410 / LSU ribosomal protein L9pPF03948Ribosomal_L9_CRibosomal protein L9, C-terminal domainno clan definedno clan defined98.6
NWMN_0428; NWMN_0499; NWMN_0501; NWMN_0641; NWMN_1592; NWMN_2151
CytoplasmicIntracellularno predicted signal peptide0151220226A6QD54YP_001331049
MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
no data available MicrobesOnline: NWMN_0012 > NWMN_0013 > NWMN_0014 > NWMN_001521166474
NWMN_0015NWMN_RS00080S. aureus NewmanSAUPAN000026000dnaCCDSdnaBreplicative DNA helicasechromosome+20767221671401unknown5332372YP_0013310503705544
ATGGATAGAATGTATGAGCAAAATCAAATGCCGCATAACAATGAAGCTGAACAGTCTGTCTTAGGTTCAATTATTATAGATCCAGAATTGATTAATACTACTCAGGAAGTTTTGCTTCCTGAGTCGTTTTATAGGGGTGCCCATCAACATATTTTCCGTGCAATGATGCACTTAAATGAAGATAATAAAGAAATTGATGTTGTAACATTGATGGATCAATTATCGACGGAAGGTACGTTGAATGAAGCGGGTGGCCCGCAATATCTTGCAGAGTTATCTACAAATGTACCAACGACGCGAAATGTTCAGTATTATACTGATATCGTTTCTAAGCATGCATTAAAACGTAGATTGATTCAAACTGCAGATAGTATTGCCAATGATGGATATAATGATGAACTTGAACTAGATGCGATTTTAAGTGATGCAGAACGTCGAATTTTAGAGCTATCATCTTCTCGTGAAAGCGATGGCTTTAAAGACATTCGAGACGTCTTAGGACAAGTGTATGAAACAGCTGAAGAGCTTGATCAAAATAGTGGTCAAACACCAGGTATACCTACAGGATATCGAGATTTAGACCAAATGACAGCAGGGTTCAACCGAAATGATTTAATTATCCTTGCAGCGCGTCCATCTGTAGGTAAGACTGCGTTCGCACTTAATATTGCACAAAAAGTTGCAACGCATGAAGATATGTATACAGTTGGTATTTTCTCGCTAGAGATGGGTGCTGATCAGTTAGCCACACGTATGATTTGTAGTTCTGGAAATGTTGACTCAAACCGCTTAAGAACGGGTACTATGACTGAGGAAGATTGGAGTCGTTTTACTATAGCGGTAGGTAAATTATCACGTACGAAGATTTTTATTGATGATACACCGGGTATTCGAATTAATGATTTACGTTCTAAATGTCGTCGATTAAAGCAAGAACATGGCTTAGACATGATTGTGATTGACTACTTACAGTTGATTCAAGGTAGTGGTTCACGTGCGTCCGATAACAGACAACAGGAAGTTTCTGAAATCTCTCGTACATTAAAAGCATTAGCCCGTGAATTAGAATGTCCAGTTATCGCATTAAGTCAGTTATCTCGTGGTGTTGAACAACGACAAGATAAACGTCCAATGATGAGTGATATTCGTGAATCTGGTTCGATTGAGCAAGATGCCGATATCGTTGCATTCTTATACCGTGATGATTACTATAACCGTGGCGGCGATGAAGATGATGACGATGATGGTGGTTTCGAGCCACAAACGAATGATGAAAACGGTGAAATTGAAATTATCATTGCTAAGCAACGTAACGGTCCAACAGGCACAGTTAAGTTACATTTTATGAAACAATATAATAAATTTACCGATATCGATTATGCACATGCAGATATGATGTAA
replicative DNA helicase4664.4176752571.3-0.5907733.6.4.12Genetic information processingDNA metabolismDNA replication, recombination, and repairreplicative DNA helicaseTIGR00665585.3CBSS-262719.3.peg.410 / Replicative DNA helicase (DnaB) (EC 3.6.4.12); DNA-replication / Replicative DNA helicase (DnaB) (EC 3.6.4.12)PF03796DnaB_CDnaB-like helicase C terminal domainCL0023P-loop_NTPase383.9
NWMN_0641; NWMN_1587; NWMN_2135
CytoplasmicIntracellularno predicted signal peptide0151220227A0A0H3K9T5YP_001331050
MDRMYEQNQMPHNNEAEQSVLGSIIIDPELINTTQEVLLPESFYRGAHQHIFRAMMHLNEDNKEIDVVTLMDQLSTEGTLNEAGGPQYLAELSTNVPTTRNVQYYTDIVSKHALKRRLIQTADSIANDGYNDELELDAILSDAERRILELSSSRESDGFKDIRDVLGQVYETAEELDQNSGQTPGIPTGYRDLDQMTAGFNRNDLIILAARPSVGKTAFALNIAQKVATHEDMYTVGIFSLEMGADQLATRMICSSGNVDSNRLRTGTMTEEDWSRFTIAVGKLSRTKIFIDDTPGIRINDLRSKCRRLKQEHGLDMIVIDYLQLIQGSGSRASDNRQQEVSEISRTLKALARELECPVIALSQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNRGGDEDDDDDGGFEPQTNDENGEIEIIIAKQRNGPTGTVKLHFMKQYNKFTDIDYAHADMM
no data available MicrobesOnline: NWMN_0012 > NWMN_0013 > NWMN_0014 > NWMN_001521166474
NWMN_0016NWMN_RS00085S. aureus NewmanSAUPAN000028000purACDSpurAadenylosuccinate synthetasechromosome+22445237281284unknown5331868YP_0013310513705545
ATGTCATCAATCGTAGTAGTTGGGACACAATGGGGAGACGAAGGAAAAGGAAAAATAACGGATTTCTTGGCAGAACAGTCAGATGTTATCGCGCGTTTTTCAGGTGGTAATAATGCAGGCCATACCATTCAATTTGGCGGAGAAACATATAAATTACATTTAGTACCATCTGGTATCTTTTACAAAGACAAATTAGCGGTAATCGGTAACGGAGTCGTTGTTGATCCAGTTGCACTATTGAAAGAATTAGACGGATTAAATGAACGTGGCATTCCTACAAGTAATTTACGTATATCTAATCGTGCGCAAGTGATTTTACCATATCACTTAGCACAAGATGAATATGAAGAACGTTTACGTGGTGACAATAAGATTGGTACAACTAAAAAAGGTATCGGTCCAGCATATGTAGACAAAGTTCAACGTATCGGTATTCGTATGGCAGATTTACTTGAAAAAGAAACATTCGAAAGATTATTAAAATCAAACATTGAATATAAACAAGCATATTTCAAAGGTATGTTTAACGAAACATGTCCATCATTTGATGATATCTTTGAAGAATATTATGCAGCAGGTCAACGTCTAAAAGAATTTGTAACAGACACATCAAAAATCTTAGACGATGCATTTGTAGCAGATGAAAAGGTACTTTTCGAAGGTGCGCAAGGTGTAATGTTAGATATCGACCATGGTACATATCCATTCGTTACATCAAGTAATCCAATTGCAGGTAACGTTACTGTTGGTACAGGTGTAGGTCCTACATTCGTTTCAAAGGTAATTGGTGTATGTAAAGCTTATACATCACGTGTTGGTGATGGTCCATTCCCTACTGAATTATTCGATGAAGATGGACATCATATTAGAGAGGTTGGTCGTGAATACGGTACAACAACAGGACGTCCACGTCGTGTAGGTTGGTTTGATTCAGTTGTATTACGTCACTCTCGTCGTGTAAGTGGTATTACAGATTTATCTATTAACTCAATCGATGTTTTAACAGGCCTAGACACAGTGAAAATCTGTACAGCTTATGAATTAGACGGTAAAGAAATTACTGAGTACCCAGCAAACTTAGATCAATTAAAACGTTGTAAACCAATCTTTGAAGAGTTACCAGGTTGGACAGAAGACGTAACAAATGTGCGTACTTTAGAAGAATTACCTGAAAATGCACGTAAATATTTAGAGCGTATTTCAGAATTATGTAATGTACAAATTTCTATCTTCTCAGTTGGTCCAGATAGAGAACAAACAAACCTATTAAAAGAATTGTGGTAG
adenylosuccinate synthetase4274.8564547578.4-0.3065576.3.4.4MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisadenylosuccinate synthaseTIGR00184595Miscellaneous / Miscellaneous - no subcategory / EC 6.3.4.- Ligases that form carbon-nitrogen bonds / Adenylosuccinate synthetase (EC 6.3.4.4); Nucleosides and Nucleotides / Purines / Purine conversions / Adenylosuccinate synthetase (EC 6.3.4.4); CBSS-262719.3.peg.410 / Adenylosuccinate synthetase (EC 6.3.4.4)PF00709Adenylsucc_syntAdenylosuccinate synthetaseCL0023P-loop_NTPase588.1
NWMN_0014; NWMN_0055; NWMN_0162; NWMN_0357; NWMN_0359; NWMN_0372; NWMN_0377; NWMN_0380; NWMN_0475; NWMN_0481; NWMN_0499; NWMN_0500; NWMN_0501; NWMN_0502; NWMN_0505; NWMN_0507; NWMN_0508; NWMN_0509; NWMN_0510; NWMN_0551; NWMN_0601; NWMN_0721; NWMN_0741; NWMN_0742; NWMN_0743; NWMN_0745; NWMN_0775; NWMN_0785; NWMN_0811; NWMN_0828; NWMN_0833; NWMN_0839; NWMN_0881; NWMN_0885; NWMN_0949; NWMN_0950; NWMN_0959; NWMN_0961; NWMN_0962; NWMN_1057; NWMN_1096; NWMN_1142; NWMN_1148; NWMN_1151; NWMN_1166; NWMN_1167; NWMN_1182; NWMN_1217; NWMN_1246; NWMN_1254; NWMN_1263; NWMN_1325; NWMN_1333; NWMN_1378; NWMN_1382; NWMN_1385; NWMN_1417; NWMN_1456; NWMN_1483; NWMN_1547; NWMN_1549; NWMN_1569; NWMN_1572; NWMN_1574; NWMN_1580; NWMN_1587; NWMN_1592; NWMN_1593; NWMN_1596; NWMN_1613; NWMN_1625; NWMN_1672; NWMN_1737; NWMN_1831; NWMN_1837; NWMN_1838; NWMN_1937; NWMN_2016; NWMN_2024; NWMN_2029; NWMN_2042; NWMN_2056; NWMN_2086; NWMN_2120; NWMN_2125; NWMN_2126; NWMN_2127; NWMN_2128; NWMN_2131; NWMN_2133; NWMN_2135; NWMN_2136; NWMN_2137; N
CytoplasmicIntracellularno predicted signal peptide0151220228A0A0H3K656YP_001331051
MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTNVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELW
no data available no polycistronic organisation predicted21166474
NWMN_tRNA01NWMN_RS00090S. aureus NewmanSAUPAN000029000trnaEtRNANWMN_tRNA01tRNA-Gluchromosome+241582422972unknown53323003705546
GGCTCCTTGGTCAAGCGGTTAAGACACCGCCCTTTCACGGCGGTAACACGGGTTCGAGTCCCGTAGGAGTCA
tRNA-Glu0no predicted signal peptideno data available MicrobesOnline: NWMN_tRNA01 > NWMN_tRNA02
NWMN_tRNA02NWMN_RS00095S. aureus NewmanSAUPAN000030000trnaDtRNANWMN_tRNA02tRNA-Aspchromosome+242402431273unknown53316473705547
GGTCTCGTAGTGTAGCGGTTAACACGCCTGCCTGTCACGCAGGAGATCGCGGGTTCGATTCCCGTCGAGACCG
tRNA-Asp0no predicted signal peptideno data available MicrobesOnline: NWMN_tRNA01 > NWMN_tRNA02
NWMN_0017NWMN_RS00100S. aureus NewmanSAUPAN000032000walRCDSvicRresponse regulator proteinchromosome+2492625633708unknown5331648YP_0013310523705548
ATGCAAATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTTAACTTAAAAAAAGAAGGATACGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGACTTAATTTATGAAGAAGAACCAGACATCGTATTACTAGATATCATGTTACCTGGTCGTGATGGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATAATAATGCTTACTGCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTAACGAAACCGTTTAGTACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCATTACTCACAACCAGCACAAGACACTGGAAATGTAACGAATGAAATCACAATTAAAGATATTGTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTAACACATCGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAACATTTATTACAAACAGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTAACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGTCACATCCTGAATATATTGTGACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG
response regulator protein2354.8121127451.1-0.478298Signal transductionRegulatory functions; Signal transductionDNA interactions; Two-component systemsphosphate regulon transcriptional regulatory protein PhoBTIGR02154235.8Iron acquisition and metabolism / Iron acquisition and metabolism - no subcategory / Heme, hemin uptake and utilization systems in GramPositives / Two-component response regulator SA14-24PF00072Response_regResponse regulator receiver domainCL0304CheY103.1
NWMN_0428; NWMN_0475; NWMN_0961; NWMN_1166; NWMN_1385; NWMN_2016; NWMN_2146; NWMN_2504
CytoplasmicIntracellularno predicted signal peptide0151220229A6QD57YP_001331052
MQMARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
no data available MicrobesOnline: NWMN_0017 > NWMN_0018 > NWMN_0019 > NWMN_0020NWMN_1953 *121166474
NWMN_0018NWMN_RS00105S. aureus NewmanSAUPAN000033000walKCDSvicKsensor kinasechromosome+25646274721827unknown5332594YP_0013310533705549
ATGAAGTGGCTAAAACAACTACAATCCCTTCATACTAAACTTGTAATTGTTTATGTATTACTGATTATCATTGGTATGCAAATTATCGGGTTATATTTTACAAATAACCTTGAAAAAGAGCTGCTTGATAATTTTAAGAAGAATATTACGCAGTACGCGAAACAATTAGAAATTAGTATTGAAAAAGTATATGACGAAAAGGGCTCCGTAAATGCACAAAAAGATATTCAAAATTTATTAAGTGAGTATGCCAACCGTCAAGAAATTGGAGAAATTCGTTTTATAGATAAAGACCAAATTATTATTGCGACGACGAAGCAGTCTAACCGTAGTCTAATCAATCAAAAAGCGAATGATAGTTCTGTCCAAAAAGCACTATCACTAGGACAATCAAACGATCATTTAATTTTAAAAGATTATGGCGGTGGTAAGGACCGTGTCTGGGTATATAATATCCCAGTTAAAGTCGATAAAAAGGTAATTGGTAATATTTATATCGAATCAAAAATTAATGACGTTTATAACCAATTAAATAATATAAATCAAATATTCATTGTTGGTACAGCTATTTCATTATTAATCACAGTCATCCTAGGATTCTTTATAGCGCGAACGATTACCAAACCAATCACCGATATGCGTAACCAGACGGTCGAAATGTCCAGAGGTAACTATACGCAACGTGTGAAGATTTATGGTAATGATGAAATTGGCGAATTAGCTTTAGCATTTAATAACTTGTCTAAACGTGTACAAGAAGCGCAGGCTAATACTGAAAGTGAGAAACGTAGACTGGACTCAGTTATCACCCATATGAGTGATGGTATTATTGCAACAGACCGCCGTGGACGTATTCGTATCGTCAATGATATGGCACTCAAGATGTTTGGTATGGCGAAAGAAGACATCATCGGATATTACATGTTAAGTGTATTAAGTCTTGAAGATGAATTTAAACTGGAAGAAATTCAAGAGAATAATGATAGTTTCTTATTAGATTTAAATGAAGAAGAAGGTCTAATCGCACGTGTTAACTTTAGTACGATTGTGCAGGAAACAGGATTTGTAACTGGTTATATCGCTGTGTTACATGACGTAACTGAACAACAACAAGTTGAACGTGAGCGTCGTGAATTTGTTGCCAATGTATCACATGAGTTACGTACACCTTTAACTTCTATGAATAGTTACATTGAAGCACTTGAAGAAGGTGCATGGAAAGATGAGGAACTTGCGCCACAATTTTTATCTGTTACCCGTGAAGAAACAGAACGAATGATTCGACTGGTCAATGACTTGCTACAGTTATCTAAAATGGATAATGAGTCTGATCAAATCAACAAAGAAATTATCGACTTTAACATGTTCATTAATAAAATTATTAATCGACATGAAATGTCTGCGAAAGATACAACATTTATTCGAGATATTCCGAAAAAGACGATTTTCACAGAATTTGATCCTGATAAAATGACGCAAGTATTTGATAATGTCATTACAAATGCGATGAAATATTCTAGAGGCGATAAACGTGTCGAGTTCCACGTGAAACAAAATCCACTTTATAATCGAATGACGATTCGTATTAAAGATAATGGCATTGGTATTCCTATCAATAAAGTCGATAAGATATTCGACCGATTCTATCGTGTAGATAAGGCACGTACGCGTAAAATGGGTGGTACTGGATTAGGACTAGCCATTTCGAAAGAGATTGTGGAAGCGCACAATGGTCGTATTTGGGCAAACAGTGTAGAAGGTCAAGGTACATCTATCTTTATCACACTTCCATGTGAAGTCATTGAAGACGGTGATTGGGATGAATAA
sensor kinase6085.3988369957.5-0.3554282.7.13.3Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR02966248.6Iron acquisition and metabolism / Iron acquisition and metabolism - no subcategory / Heme, hemin uptake and utilization systems in GramPositives / Two-component sensor kinase SA14-24PF02518HATPase_cHistidine kinase-, DNA gyrase B-, and HSP90-like ATPaseCL0025His_Kinase_A92.9
NWMN_0017; NWMN_1166; NWMN_2135
Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide2151220230A6QD58YP_001331053
MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNINQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMFGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEVIEDGDWDE
no data available MicrobesOnline: NWMN_0017 > NWMN_0018 > NWMN_0019 > NWMN_0020NWMN_1953 *121166474
NWMN_0019NWMN_RS00110S. aureus NewmanSAUPAN000034000walHCDSNWMN_0019hypothetical proteinchromosome+27438287991362unknown5332593YP_0013310543705550
GTGAAGTCATTGAAGACGGTGATTGGGATGAATAATAAGGAGCATATTAAATCTGTCATTTTAGCACTACTCGTCTTGATGAGTGTCGTATTGACATATATGGTATGGAACTTTTCTCCTGATATTGCAAATGTCGACAATACAGATAGTAAGAAGAGTGAAACGAAACCTTTAACGACACCTATGACAGCCAAAATGGATACAACTATTACGCCATTTCAGATTATTCATTCGAAAAATGATCATCCAGAAGGAACGATTGCGACGGTATCTAATGTGAATAAACTGACGAAACCTTTGAAAAATAAAGAAGTGAAGTCCGTGGAACATGTTCGTCGTGATCATAACTTGATGATTCCTGATTTGAACAGTGATTTTATATTATTCGATTTTACGTATGATTTACCGTTATCAACATATCTTGGTCAAGTACTGAACATGAATGCGAAAGTACCAAATCATTTCAATTTCAATCGTTTGGTCATAGATCATGATGCTGATGATAATATCGTGCTTTATGCTATAAGCAAAGATCGCCACGATTACGTAAAATTAACAACTACAACGAAAAATGATCATTTTTTAGATGCATTAGCAGCAGTGAAAAAAGATATGCAACCATACACAGATATCATCACAAACAAAGATACAATTGATCGTACGACGCATGTTTTTGCACCAAGTAAACCTGAAAAGTTAAAAACATATCGCATGGTATTTAACACGATTAGTGTTGAGAAAATGAATGCTATACTATTTGACGATTCAACCATCGTTCGTAGTTCAAAGAGTGGTGTTACAACCTACAACAATAATACAGGTGTCGCAAACTATAACGATAAAAATGAAAAATATCATTATAAAAACCTGTCCGAAGATGAAGCGAGTTCCAGCAAAATGGAAGAAACGATTCCAGGAACCTTTGATTTTATTAATGGTCATGGTGGTTTCTTAAACGAAGACTTTAGATTGTTTAGTACGAATAATCAGTCAGGCGAGTTAACATATCAACGTTTCCTTAATGGTTATCCAACGTTTAATAAAGAAGGTTCTAATCAAATTCAAGTCACTTGGGGTGAAAAAGGCGTCTTTGACTATCGTCGTTCGTTATTACGCACCGACGTTGTTTTAAATAGTGAGGATAATAAATCGTTGCCGAAATTAGAGTCTGTACGTTCAAGCTTAGCGAACAATAGTGATATTAATTTTGAAAAAGTAACAAACATCGCTATCGGTTACGAAATGCAGGATAATTCAGATCATAATCACATTGAAGTGCAGATTAACAGTGAACTCGTACCGCGTTGGTATGTAGAATATGATGGCGAATGGTATGTTTATAACGATGGGAGGCTTGAATAA
hypothetical protein4536.0314651882.9-0.563355Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein CTIGR0171316.6Cofactors, Vitamins, Prosthetic Groups, Pigments / Tetrapyrroles / CPO analysis / FIG011501: YycH proteinPF07435YycHYycH proteinCL0285YycI_YycH451.4no significant predictionN-terminally anchored (No CS)no predicted signal peptide1151220231A0A0H3KD70YP_001331054
MKSLKTVIGMNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTTPMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIPDLNSDFILFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRHDYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVFNTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKMEETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGEKGVFDYRRSLLRTDVVLNSEDNKSLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSDHNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
no data available MicrobesOnline: NWMN_0017 > NWMN_0018 > NWMN_0019 > NWMN_002026999783
NWMN_0020NWMN_RS00115S. aureus NewmanSAUPAN000035000walICDSNWMN_0020hypothetical proteinchromosome+2880029588789unknown5329926YP_0013310553705551
ATGAACTGGAAACTGACAAAGACACTTTTCATTTTCGTGTTTATTCTTGTCAACATCGTGTTAGTATCGATTTATGTTAATAAAGTCAATCGCTCACACATTAATGAAGTCGAGAGTAACAATGAAGTTAATTTTCAGCAAGAAGAAATTAAAGTACCGACTAGTATATTGAATAAATCAGTTAAAGGTATAAAATTAGAGCAAATTACAGGGCGATCAAAAGACTTTAGTTCTAAAGCTAAAGGCGATTCGGATTTGACCACATCAGATGGTGGAAAATTATTGAATGCGAACATTAGTCAATCGGTAAAGGTCAGTGACAATAACTTAAAAGATTTGAAAGATTATGTTAACAAGCGCGTATTTAAAGGTGCTGAATATCAATTAAGCGAGATTAGTTCAGATTCTGTAAAATATGAACAAACGTATGATGATTTTCCGATTTTAAATAACAGTAAAGCGATGTTGAACTTTAATATAGAAGATAACAAAGCGACTAGTTATAAACAATCAATGATGGATGACATTAAGCCCACAGATGGTGCAGATAAGAAGCATCAAGTGATTGGTGTGAGAAAAGCAATCGAGGCATTATATTATAATCGTTACTTGAAAAAAGGTGATGAAGTCATTAATGCTAGACTCGGTTACTACTCAGTCGTGAATGAAACGAATGTTCAATTGTTACAACCAAACTGGGAAATTAAAGTGAAGCATGACGGTAAGGATAAAACGAATACTTACTATGTCGAAGCGACAAATAATAACCCTAAAATTATTAATCATTAA
hypothetical protein2629.3692429931.6-0.621756Cofactors, Vitamins, Prosthetic Groups, Pigments / Tetrapyrroles / CPO analysis / hypothetical protein SA_21PF09648YycIYycH proteinCL0285YycI_YycH175no significant predictionN-terminally anchored (No CS)no predicted signal peptide1151220232A0A0H3K5H4YP_001331055
MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNFQQEEIKVPTSILNKSVKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVKVSDNNLKDLKDYVNKRVFKGAEYQLSEISSDSVKYEQTYDDFPILNNSKAMLNFNIEDNKATSYKQSMMDDIKPTDGADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVNETNVQLLQPNWEIKVKHDGKDKTNTYYVEATNNNPKIINH
no data available MicrobesOnline: NWMN_0017 > NWMN_0018 > NWMN_0019 > NWMN_002026999783
NWMN_0021NWMN_RS00120S. aureus NewmanSAUPAN000036000walJCDSNWMN_0021metallo-beta-lactamase superfamily proteinchromosome+2997830778801unknown5329927YP_0013310563705552
ATGAGCCGCTTGATACGCATGAGTGTATTAGCAAGTGGTAGTACAGGTAACGCCACTTTTGTAGAAAATGAAAAAGGTAGTCTATTAGTTGATGTTGGTTTGACTGGAAAGAAAATGGAAGAATTGTTTAGTCAAATTGACCGTAATATTCAAGATTTAAATGGTATTTTAGTAACCCATGAACATATTGATCATATTAAAGGATTAGGTGTTTTGGCGCGTAAATATCAATTGCCAATTTATGCGAATGAAAAGACTTGGCAGGCAATTGAAAAGAAAGATAGTCGCATCCCTATGGATCAGAAATTCATTTTTAATCCTTATGAAACAAAATCTATTGCAGGTTTCGATGTTGAATCGTTTAACGTGTCACATGATGCAATAGATCCGCAATTTTATATTTTCCATAATAACTATAAGAAGTTTACGATTTTAACGGATACGGGTTACGTGTCTGATCGTATGAAAGGTATGATACGTGGCAGCGATGCGTTTATTTTTGAGAGTAATCATGACGTCGATATGTTGAGAATGTGTCGTTATCCATGGAAGACGAAACAACGTATTTTAGGCGATATGGGTCATGTATCTAATGAGGATGCGGCTCATGCAATGACAGACGTGATTACAGGTAACACGAAACGTATTTACCTATCGCATTTATCACAAGACAATAACATGAAAGATTTGGCGCGTATGAGTGTTGGCCAAGTATTGAACGAACACGATATTGATACGGAAAAAGAAGTATTGCTATGTGATACGGATAAAGCTATTCCAACGCCAATATATACAATATAA
metallo-beta-lactamase superfamily protein2666.3490430327.4-0.397368Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341333.5Heme, hemin uptake and utilization systems in GramPositives / Zn-dependent hydrolase YycJ/WalJ, required for cell wall metabolism and coordination of cell division with DNA replicationPF00753Lactamase_BMetallo-beta-lactamase superfamilyCL0381Metallo-HOrase81.1CytoplasmicIntracellularno predicted signal peptide0151220233A0A0H3K605YP_001331056
MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQIDRNIQDLNGILVTHEHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFIFNPYETKSIAGFDVESFNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSDAFIFESNHDVDMLRMCRYPWKTKQRILGDMGHVSNEDAAHAMTDVITGNTKRIYLSHLSQDNNMKDLARMSVGQVLNEHDIDTEKEVLLCDTDKAIPTPIYTI
no data available no polycistronic organisation predicted26999783
NWMN_0022NWMN_RS00125S. aureus NewmanSAUPAN000037000adsACDSNWMN_0022hypothetical proteinchromosome+31006333242319unknown5329928YP_0013310573705553
ATGAAAGCTTTATTACTTAAAACAAGTGTATGGCTCGTTTTGCTTTTTAGTGTAATGGGATTATGGCAAGTCTCGAACGCGGCTGAGCAGCATACACCAATGAAAGCACATGCAGTAACAACGATAGACAAAGCAACAACAGATAAGCAACAAGTACCGCCAACAAAGGAAGCGGCTCATCATTCTGGCAAAGAAGCGGCAACCAACGTATCAGCATCAGCGCAGGGAACAGCTGATGATACAAACAGCAAAGTAACATCCAACGCACCATCTAACAAACCATCTACAGTAGTTTCAACAAAAGTAAACGAAACACGCGACGTAGATACACAACAAGCCTCAACACAAAAACCAACTCACACAGCAACGTTCAAATTATCAAATGCTAAAACAGCATCACTTTCACCACGAATGTTTGCTGCTAATGCACCACAAACAACAACACATAAAATATTACATACAAATGATATCCATGGCCGACTAGCCGAAGAAAAAGGGCGTGTCATCGGTATGGCTAAATTAAAAACAGTAAAAGAACAAGAAAAGCCTGATTTAATGTTAGACGCAGGAGACGCCTTCCAAGGTTTACCACTTTCAAACCAGTCTAAAGGTGAAGAAATGGCTAAAGCAATGAATGCAGTAGGTTATGATGCTATGGCAGTCGGTAACCATGAATTTGACTTTGGATACGATCAGTTGAAAAAGTTAGAGGGTATGTTAGACTTCCCGATGCTAAGTACTAACGTTTATAAAGATGGAAAACGCGCGTTTAAGCCTTCAACGATTGTAACAAAAAATGGTATTCGTTATGGAATTATTGGTGTAACGACACCAGAAACAAAGACGAAAACAAGACCTGAAGGCATTAAAGGCGTTGAATTTAGAGATCCATTACAAAGTGTGACAGCGGAAATGATGCGTATTTATAAAGACGTAGATACATTTGTTGTTATATCACATTTAGGAATTGATCCTTCAACACAAGAAACATGGCGTGGTGATTACTTAGTGAAACAATTAAGTCAAAATCCACAATTGAAGAAACGTATTACAGTTATTGATGGTCATTCACATACAGTACTTCAAAATGGTCAAATTTATAACAATGATGCATTGGCACAAACAGGTACAGCACTTGCGAATATCGGTAAGATTACATTTAATTATCGCAATGGAGAGGTATCGAATATTAAACCGTCATTGATTAATGTTAAAGACGTTGAAAATGTAACACCGAACAAAGCATTAGCTGAACAAATTAATCAAGCTGATCAAACATTTAGAGCACAAACTGCAGAGGTAATTATTCCAAACAATACCATTGATTTCAAAGGAGAAAGAGATGACGTTAGAACGCGTGAAACAAATTTAGGAAACGCGATTGCAGATGCTATGGAAGCGTATGGCGTTAAGAATTTCTCTAAAAAGACTGACTTTGCCGTGACAAATGGTGGAGGTATTCGTGCCTCTATCGCAAAAGGTAAGGTGACACGCTATGATTTAATCTCAGTATTACCATTTGGAAATACGATTGCGCAAATTGATGTAAAAGGTTCAGACGTCTGGACGGCTTTCGAACATAGTTTAGGCGCACCAACAACACAAAAGGACGGTAAGACAGTGTTAACAGCGAATGGCGGTTTACTACATATCTCTGATTCAATCCGTGTTTACTATGATATAAATAAACCGTCTGGCAAACGAATTAATGCTATTCAAATTTTAAATAAAGAGACAGGTAAGTTTGAAAATATTGATTTAAAACGTGTATATCACGTAACGATGAATGACTTCACAGCATCAGGTGGCGACGGATATAGTATGTTCGGTGGTCCTAGAGAAGAAGGTATTTCATTAGATCAAGTACTAGCAAGTTATTTAAAAACAGCTAACTTAGCTAAGTATGATACGACAGAACCACAACGTATGTTATTAGGTAAACCAGCAGTAAGTGAACAACCAGCTAAAGGACAACAAGGTAGCAAAGGTAGTAAGTCTGGTAAAGATACACAACCAATTGGTGACGACAAAGTGATGGATCCAGCGAAAAAACCAGCTCCAGGTAAAGTTGTATTGTTGCTAGCGCATAGAGGAACTGTTAGTAGCGGTACAGAAGGTTCTGGTCGCACAATAGAAGGAGCTACTGTATCAAGCAAGAGTGGGAAACAATTGGCTAGAATGTCAGTGCCTAAAGGTAGCGCGCATGAGAAACAGTTACCAAAAACTGGAACTAATCAAAGTTCAAGCCCAGAAGCGATGTTTGTATTATTAGCAGGTATAGGTTTAATCGCGACTGTACGACGTAGAAAAGCTAGCTAA
hypothetical protein77210.049383424-0.480959MetabolismBiosynthesis of cofactors, prosthetic groups, and carriers; Transport and binding proteinsPyridine nucleotides; OtherNAD nucleotidaseTIGR01530134.4Nucleosides and Nucleotides / Purines / Purine conversions / 5'-nucleotidase (EC 3.1.3.5); Nucleosides and Nucleotides / Pyrimidines / pyrimidine conversions / 5'-nucleotidase (EC 3.1.3.5); Virulence, Disease and Defense / Adhesion / Adhesins in Staphylococcus / Virulence-associated cell-wall-anchored protein SasH (LPXTG motif)PF028725_nucleotid_C5'-nucleotidase, C-terminal domainno clan definedno clan defined141.4CellwallLPxTG Cell-wall anchoredsignal peptide predicted0151220234A0A0H3K9U4YP_001331057
MKALLLKTSVWLVLLFSVMGLWQVSNAAEQHTPMKAHAVTTIDKATTDKQQVPPTKEAAHHSGKEAATNVSASAQGTADDTNSKVTSNAPSNKPSTVVSTKVNETRDVDTQQASTQKPTHTATFKLSNAKTASLSPRMFAANAPQTTTHKILHTNDIHGRLAEEKGRVIGMAKLKTVKEQEKPDLMLDAGDAFQGLPLSNQSKGEEMAKAMNAVGYDAMAVGNHEFDFGYDQLKKLEGMLDFPMLSTNVYKDGKRAFKPSTIVTKNGIRYGIIGVTTPETKTKTRPEGIKGVEFRDPLQSVTAEMMRIYKDVDTFVVISHLGIDPSTQETWRGDYLVKQLSQNPQLKKRITVIDGHSHTVLQNGQIYNNDALAQTGTALANIGKITFNYRNGEVSNIKPSLINVKDVENVTPNKALAEQINQADQTFRAQTAEVIIPNNTIDFKGERDDVRTRETNLGNAIADAMEAYGVKNFSKKTDFAVTNGGGIRASIAKGKVTRYDLISVLPFGNTIAQIDVKGSDVWTAFEHSLGAPTTQKDGKTVLTANGGLLHISDSIRVYYDINKPSGKRINAIQILNKETGKFENIDLKRVYHVTMNDFTASGGDGYSMFGGPREEGISLDQVLASYLKTANLAKYDTTEPQRMLLGKPAVSEQPAKGQQGSKGSKSGKDTQPIGDDKVMDPAKKPAPGKVVLLLAHRGTVSSGTEGSGRTIEGATVSSKSGKQLARMSVPKGSAHEKQLPKTGTNQSSSPEAMFVLLAGIGLIATVRRRKAS
no data available no polycistronic organisation predicted19808256; 22035583; 22088393
NWMN_0023NWMN_RS00130S. aureus NewmanSAUPAN000040000orfXCDSorfXrRNA large subunit methyltransferasechromosome+3369234171480unknown5329929YP_0013310583705554
ATGAAAATCACCATTTTAGCTGTAGGGAAACTAAAAGAGAAATATTGGAAGCAAGCCATAGCAGAATATGAAAAACGTTTAGGCCCATACACCAAGATAGACATCATAGAAGTTCCAGACGAAAAAGCACCAGAAAATATGAGTGACAAAGAAATTGAGCAAGTAAAAGAAAAAGAAGGCCAACGAATACTAGCCAAAATCAAACCACAATCCACAGTCATTACATTAGAAATACAAGGAAAGATGCTATCTTCCGAAGGATTGGCCCAAGAATTGAACCAACGCATGACCCAAGGGCAAAGCGACTTTGTTTTCGTCATTGGCGGATCAAACGGCCTGCACAAGGACGTCTTACAACGCAGTAACTACGCACTATCATTCAGCAAAATGACATTCCCACATCAAATGATGCGGGTTGTGTTAATTGAACAAGTGTACAGAGCATTTAAGATTATGCGAGGAGAGGCGTATCATAAGTAA
rRNA large subunit methyltransferase1599.8588518306.2-0.4616352.1.1.177Genetic information processingProtein synthesistRNA and rRNA base modificationrRNA large subunit m3Psi methyltransferase RlmHTIGR00246186.6Ribosome biogenesis bacterial / 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase (EC 2.1.1.177)PF02590SPOUT_MTasePredicted SPOUT methyltransferaseCL0098SPOUT206.9CytoplasmicIntracellularno predicted signal peptide0151220235A6QD63YP_001331058
MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
no data available no polycistronic organisation predicted
NWMN_0024NWMN_RS00145S. aureus NewmanSAUPAN000832000-CDSNWMN_0024hypothetical proteinchromosome+34713364581746unknown5332231YP_0013310593705555
ATGAAGATTAATATTTATAAATCTATTTATAATTTTCAGGAAACAAATACAAATTTTTTAGAGAATCTAGAATCTTTAAATGATGACAATTATGAACTGCTTAATGATAAAGAACTTGTTAGTGATTCAAATGAATTAAAATTAATTAGTAAAGTTTATATACGTAAAAAAGACAAAAAACTATTAGATTGGCAATTATTAATAAAGAATGTATACCTAGATACTGAAGAAGATGACAATTTATTTTCAGAATCCGGTCATCATTTTGATGCAATATTATTTCTCAAAGAAGATACAACATTACAAAATAATGTATATATTATACCTTTTGGACAAGCATATCATGATATAAATAATTTGATTGATTATGACTTCGGAATTGATTTTGCAGAAAGAGCAATCAAAAATGAAGACATAGTTAATAAAAATGTTAATTTTTTTCAACAAAACAGGCTTAAAGAGATTGTTAATTATAGAAGGAATAGTGTAGATTACGTTAGACCTTCAGAATCTTATATATCAGTCCAAGGACATCCACAGAATCCTCAAATTTTTGGAAAAACAATGACTTGTGGTACAAGTATTTCATTGCGTGTACCGAATAGAAAGCAGCAATTCATAGATAAAATTAGTGTGATAATCAAAGAAATAAACGCTATTATTAATCTTCCTCAAAAAATTAGTGAATTTCCTAGAATAGTAACTTTAAAAGACTTGAATAAAATAGAAGTATTAGATACTTTATTGCTAAAAAAACTATCGAATTCTTCAACTACAGAAAATATATCTATAGATATATCAAGATTTTTAGAACTAAGTAATATGATACTCTTGTTAGATGATATGCTCGACGTCAATATATATATAAATTCTTTTAAAAATAATACATTAGAGACATTTGATGCGACTGATCCTGAAGTTGATTACATCACTGAAATAGGAGATTACTTATTAAAATATGACGTTAATTCTATAAATGATGTCAGAATTGAAGTGATAGATAATTTGGGGCATTCAAATAATATGCTACTAAAAACGATACTACATGCAGAAGTTGAAATGGAAGATGGAAAGAAATATTTATTACAAAATGGGAAATGGGGTTATTTTAATAGAGAATTTTTTGACCTTTTGAATGATCATTTGAATGAGATAGAAATTAGGTATAACACACTAACTCCCACAGGTTTAGTATTTAAAGAAGGAGAAGAAGGATATATAAAAGAAATAGTAGGAAGATTGCCAGAAGAATATTTAATGTTACATAAAAAATTCATAAAACCAATAAATAAGAATTTTATAGTAAAAGGAAATGGAATAGAGTTGGCAGACTTATACAATATTAAAAACAAAGAGCTTTTCACGATTAAAAGAGGAATTAATACATCTTTATCTCTTTATAGTCTAGAACAGAATATAATAGCAATTAACGCCTTAAAATATCCAGAATCATATAATTTTGAAGAATTAATAGAAGCTATTCCTGATAACTCGGAAAATATATTTAATGATATACAACGGAGTACAAATTTTAGTATAGTATGGATTTTACCGATATCATCTATTGATAATATGCCCATAAAAGATATGGTTCATACTAGTAACGTAATAAATAAAAACTTTCAATTAACTAATTTAGGTTCAGTATTACTTAAAAATAAATTAGTAGAGTGGTCTCTCTATTTAAAAGATCAAAGAATTAATCCAATTATTTATATGGAAACGCCAACTGAAGATAGAAATTAA
hypothetical protein5814.692267780.7-0.354733sporadically distributed protein, TIGR04141 familyTIGR0414190.6Arginine Biosynthesis extended / hypothetical proteinPF09101Exotox-A_bindExotoxin A bindingCL0004Concanavalin9.3CytoplasmicIntracellularno predicted signal peptide0151220236A0A0H3K660YP_001331059
MKINIYKSIYNFQETNTNFLENLESLNDDNYELLNDKELVSDSNELKLISKVYIRKKDKKLLDWQLLIKNVYLDTEEDDNLFSESGHHFDAILFLKEDTTLQNNVYIIPFGQAYHDINNLIDYDFGIDFAERAIKNEDIVNKNVNFFQQNRLKEIVNYRRNSVDYVRPSESYISVQGHPQNPQIFGKTMTCGTSISLRVPNRKQQFIDKISVIIKEINAIINLPQKISEFPRIVTLKDLNKIEVLDTLLLKKLSNSSTTENISIDISRFLELSNMILLLDDMLDVNIYINSFKNNTLETFDATDPEVDYITEIGDYLLKYDVNSINDVRIEVIDNLGHSNNMLLKTILHAEVEMEDGKKYLLQNGKWGYFNREFFDLLNDHLNEIEIRYNTLTPTGLVFKEGEEGYIKEIVGRLPEEYLMLHKKFIKPINKNFIVKGNGIELADLYNIKNKELFTIKRGINTSLSLYSLEQNIIAINALKYPESYNFEELIEAIPDNSENIFNDIQRSTNFSIVWILPISSIDNMPIKDMVHTSNVINKNFQLTNLGSVLLKNKLVEWSLYLKDQRINPIIYMETPTEDRN
no data available no polycistronic organisation predicted
NWMN_0025NWMN_RS00150S. aureus NewmanSAUPAN000051000-CDSNWMN_0025hypothetical proteinchromosome-3655237004453unknown5329930YP_0013310603705556
ATGAGTAAAGTAGATGCACATTGGGAATTAATCGAAGCTATTAAAAATTTACGTGACGAAATTGCACCAAACACATTGTTAACAATTAACGATGATATTCCCGATAGAAAAACAGGACTTGAACTTGCAGAAAAATATGGTATTGATGGCATCATGATTGGTAGAGGCATTTTCCACAATCCATTCACTTTTGAAAAAGAACCACGCGAACACACAAGCAAAGAACTATTAGATTTGTTGAGATTGCATCTATCATTGTTTAACAAATATGAGAAAGATGAAATACGACAATTCAAGAGTTTGCGTAGATTCTTTAAAATCTATGTGCGTGGCATAAGAGGCGCTAGCGAACTTCGCCATCAATTGATGAACACACAATCAATTGCAGAAGTACGAGCACTACTAGATGAATTTGAAGCCCAAATGGACGAAGACGTTAAAATTGAATTATAG
hypothetical protein1505.6670617640.1-0.483333Unknown functionGeneralputative TIM-barrel protein, nifR3 familyTIGR0073746.9RNA Metabolism / RNA processing and modification / tRNA modification Archaea / tRNA dihydrouridine synthase B (EC 1.-.-.-)PF01207DusDihydrouridine synthase (Dus)CL0036TIM_barrel45.9CytoplasmicIntracellularno predicted signal peptide0151220237A0A0H3KD75YP_001331060
MSKVDAHWELIEAIKNLRDEIAPNTLLTINDDIPDRKTGLELAEKYGIDGIMIGRGIFHNPFTFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQLMNTQSIAEVRALLDEFEAQMDEDVKIEL
no data available no polycistronic organisation predicted
NWMN_0026NWMN_RS00160S. aureus NewmanSAUPAN000489000tauECDSNWMN_0026hypothetical proteinchromosome-3721937974756unknown5329931YP_0013310613705557
ATGGATATTGTTAATATAGTTATCATGTTACTCATTGGGGTATTCGGTGGGTTCATATCTGGTCTAGTAGGCGTAGGTGGTGCTATCATTATTTATCCAGCTATTTTATTATTACCACCATTATTCGGAGCCCCTGCATATAGCGCATATATCGCATCAGGTCTTACTTCTAGCCAAGTCTTTTTCAGTACATTAAGTGGCTCATTAAAAGCTCGAAAAAAAACAGAGTTCTCGCCACAATTAGTTCTTTATATGGGTGGCGGCATGATTATAGGGAGTATGTTAGGTGCATTTCTAGCAAATTTATTTGATGCTACATTTGTAAATACGGTATATATCATTATTGCTTTACTTGCATTAACATTAATGTTTATTAAAGTGAAACCTAGTTCCGAAAAGTCTTCATTTAATAAATATTTATTAGTTATCATTGGCCTTTTCATTGGTATTATTTCAGGTATAGTAGGTGCAGGTGGTGCCTTCATTATTATTCCTATATTATTGGTTTTATTCAAATTACCAATGAATACTGTAGTCGCTAATAGTATAGTAATTGCTTTTATATCTTCAATTGGTGCTTTTGTCATCAAACTTATTCAAGGTTATATCCCTTTATATGACGCCTTATTCCTTATAATAGGGAGTATTATATTTGCTCCAATAGGGTTAAAATTAAGTAAAAAAGTCCCTAACATAATACAAAAATGGATTATCAGTATTTTAATCGTTTTTGCTATAGTTCAACTCATTTTATAA
hypothetical protein25110.298526690.61.3992FIG003846: hypothetical proteinPF01925TauESulfite exporter TauE/SafECL0292LysE140.8Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide7151220238A0A0H3K5H7YP_001331061
MDIVNIVIMLLIGVFGGFISGLVGVGGAIIIYPAILLLPPLFGAPAYSAYIASGLTSSQVFFSTLSGSLKARKKTEFSPQLVLYMGGGMIIGSMLGAFLANLFDATFVNTVYIIIALLALTLMFIKVKPSSEKSSFNKYLLVIIGLFIGIISGIVGAGGAFIIIPILLVLFKLPMNTVVANSIVIAFISSIGAFVIKLIQGYIPLYDALFLIIGSIIFAPIGLKLSKKVPNIIQKWIISILIVFAIVQLIL
no data available no polycistronic organisation predicted26177047
NWMN_0027NWMN_RS00170S. aureus NewmanSAUPAN000487000cstACDSNWMN_0027hypothetical proteinchromosome+38371394381068unknown5329932YP_0013310623705558
ATGAAACAATACGGAGAAAAGTTTATCGATGAATTTAGTAAAGCAGAATTGGAAAAACTAGCCAAGCAAGGGCAATTAATTGACGTTAGAACAGAAGAGGAGTATGCATTAGGACATATCAATGGTTCCATACTTCATCCTGTTGATGAGATTGAGTCATTCAATAAAGAAAAAAATAAAACCTATTATGTAATCTGTAGAAGTGGTAACAGAAGTGCTAATGCTAGTAAATATTTAGCTAAACAAGGTTATAACGTTATAAATCTTGATGGTGGTTATAAAGCTTATGAAGAAGAAAACGATAGTTATGATACACAAGAAGAATATAAAAGTATAGAAATTAAAGCAGATCGTAAACAATTTAACTATCGTGGTCTTCAATGTCCAGGGCCAATTGTAAAAATTAGTCAAGAAATGAAGAATATTGAAGTAGGTGACCAAATTGAAGTCAAAGTCACAGACCCTGGATTCCCTAGTGACATTAAAAGTTGGGTGAAACAAACAAGGCATACTTTAGTTAAGCTTGATGAAAATAACAATGGAATTAATGCGATTATTCAAAAAGAAAAAGCAAAAGATTTAGATATAAATTATTCTGCTAAAGGTACTACAATTGTATTATTTAGTGGAGAATTAGACAAAGCTGTAGCAGCGTTGATTATTGCAAATGGTGCTAGAGCTGCTGGAAAAGATGTAACTATCTTCTTTACTTTTTGGGGGCTTAATGCATTAAAAAAAGTGCAAACAGTTAATGTTAAAAAGCAAGGTATTGCAAAAATGTTTGATTTAATGTTGCCCAAAAAGAATATACGAATGCCTCTTTCCAAAATGAATATGTTTGGTTTAGGAAATATGATGATGCGCTACGTAATGAAAAAGAAAAATGTTGATTCATTACCAACACTTATCAATCAAGCTATTGAGCAAAATATCAAATTAATCGCTTGTACGATGAGTATGGATGTCATGGGTATTCAGAAAGAAGAACTTAGAGATGAAGTTGAGTACGGTGGTGTAGGCACTTATATTGGTGCTACTGAAAATGCGAATCATAATTTATTTATCTAA
hypothetical protein3558.3664640086.8-0.448169Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA 2-selenouridine synthaseTIGR0316736.7Disulfide bond regulatorPF13686DrsE_2DsrE/DsrF/DrsH-like familyCL0394DsrEFH-like195.4no significant predictionIntracellularno predicted signal peptide0151220239A0A0H3K610YP_001331062
MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSILHPVDEIESFNKEKNKTYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAYEEENDSYDTQEEYKSIEIKADRKQFNYRGLQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKSWVKQTRHTLVKLDENNNGINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIANGARAAGKDVTIFFTFWGLNALKKVQTVNVKKQGIAKMFDLMLPKKNIRMPLSKMNMFGLGNMMMRYVMKKKNVDSLPTLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVGTYIGATENANHNLFI
no data available MicrobesOnline: NWMN_0027 > NWMN_0028 > NWMN_002926177047
NWMN_0028NWMN_RS00175S. aureus NewmanSAUPAN000486000cstBCDSNWMN_0028metallo-beta-lactamase superfamily proteinchromosome+39469408031335unknown5329933YP_0013310633705559
ATGTTTTTTAAACAGTTTTACGATAATCATTTATCTCAAGCATCATATTTAGTGGGTTGTCAACGTACAGGAGAGGCAATAATAATAGACCCTGTTCGTGATTTATCGAAATATATAGAAGTTGCAGATTCTGAAGGTTTAACAATTACACAAGCTACAGAAACACATATTCATGCTGATTTTGCTTCAGGAATTCGTGATGTGGCTAAACGCTTAAATGCAAATATATATGTGTCTGGCGAAGGTGAAGATGCATTAGGGTATAAAAATATGCCATCAAAAACACAATTTGTTAAACATGGAGATATCATTCAAGTAGGCAATGTTAAATTAGAAGTTCTGCATACTCCAGGACACACGCCTGAAAGTATTAGCTTTTTACTCACTGATTTAGGTGGTGGTTCAAGTGTTCCGATGGGATTATTTAGTGGTGACTTTATTTTTGTTGGTGATATAGGTAGACCTGATTTATTAGAAAAATCTGTTCAAATAAAGGGTTCTACAGAAATTAGCGCGAAACAAATGTATGAGTCCGTTCAAAATATTAAAAATTTACCAGACTATGTTCAAATCTGGCCGGGTCATGGTGCTGGAAGCCCTTGTGGTAAAGCATTAGGTGCCATACCTATATCTACAATAGGTTATGAGAAAATTAATAACTGGGCATTTAATGAAATTGATGAGACTAAATTTATTGAATCATTAACATCAAATCAACCAGCACCACCGCATCATTTTGCACAAATGAAACAAGTTAATCAGTTTGGTATGAATTTATATCAATCATATGATGTTTATCCTAGTTTAGATAATAAGAGAGTAGCATTTGATCTTCGTAGCAAAGAGGCCTTTCACGGTGGCCACACAAAAGGAACAATCAATATACCATACAACAAAAACTTTATTAATCAAATTGGTTGGTACTTAGATTTTGAAAAAGATATAGATTTAATTGGAGATAAATCTACTGTTGAGAAAGCGAAACACACTTTACAATTAATTGGGTTTGATAAGGTAGCAGGCTATCGTTTGCCAAAATCAGGCATTTCAACCCAGTCCGTTCATAGCGCTGATATGACAGGTAAAGAAGAACATGTATTAGACGTACGTAATGATGAAGAGTGGAATAATGGACACTTAGATCAAGCAGTTAATATTCCGCATGGTAAATTATTAAATGAAAATATTCCTTTTAATAAAGAGGATAAAATATATGTACATTGTCAGTCAGGTGTTAGAAGTTCAATTGCAGTGGGTATATTGGAAAGCAAAGGTTTTGAAAATGTGGTGAATATTAGAGAAGGCTATCAAGATTTTCCAGAATCATTAAAATAA
metallo-beta-lactamase superfamily protein4445.9367449351.1-0.397297Cellular processesCellular processesDetoxificationhydroxyacylglutathione hydrolaseTIGR0341378.1Zn-dependent hydroxyacylglutathione hydrolase / Polysulfide binding proteinPF00581RhodaneseRhodanese-like domainCL0031Phosphatase61.1CytoplasmicIntracellularno predicted signal peptide0151220240A0A0H3K9V0YP_001331063
MFFKQFYDNHLSQASYLVGCQRTGEAIIIDPVRDLSKYIEVADSEGLTITQATETHIHADFASGIRDVAKRLNANIYVSGEGEDALGYKNMPSKTQFVKHGDIIQVGNVKLEVLHTPGHTPESISFLLTDLGGGSSVPMGLFSGDFIFVGDIGRPDLLEKSVQIKGSTEISAKQMYESVQNIKNLPDYVQIWPGHGAGSPCGKALGAIPISTIGYEKINNWAFNEIDETKFIESLTSNQPAPPHHFAQMKQVNQFGMNLYQSYDVYPSLDNKRVAFDLRSKEAFHGGHTKGTINIPYNKNFINQIGWYLDFEKDIDLIGDKSTVEKAKHTLQLIGFDKVAGYRLPKSGISTQSVHSADMTGKEEHVLDVRNDEEWNNGHLDQAVNIPHGKLLNENIPFNKEDKIYVHCQSGVRSSIAVGILESKGFENVVNIREGYQDFPESLK
no data available MicrobesOnline: NWMN_0027 > NWMN_0028 > NWMN_002926177047
NWMN_0029NWMN_RS00180S. aureus NewmanSAUPAN000838000sqrCDSNWMN_0029hypothetical proteinchromosome+40813420151203unknown5329934YP_0013310643705560
GTGGAAAAAATGAATAAGCATTATCAAATTGTTATTATTGGTGGCGGTACAGCAGGTGTTACCGTAGCATCAAGACTATTAAGAAAAAATCAAAACTTAAAAGAGAAAATAGCAATTATAGATCCAGCAGACCATCATTACTATCAACCATTATGGACGTTGGTTGGTGCAGGGGTATCTAGTTTGAAAAGTTCTCGTAAAGATATGGAAAGTGTTATACCTGAAGGTGCTAACTGGATAAAACAGGCTGTTTCAAGTTTTCAACCTGAAAATAATAGCGTTATTTTAGGAGATAATACAGTCGTTTATTATGATTTTTTAGTAGTAGCTCCAGGATTACAGATTAATTGGTCTTCAATTAAAGGACTAAAAGAAAATATAGGTAAAAATGGTGTTTGCTCTAACTATTCACCTGACTATGTTAACGAAACTTGGAACCAAATTTCTAATTTTAAACAAGGAAATGCCATTTTTACGCATCCAAACACTCCTATAAAGTGTGGAGGTGCGCCTATGAAAATTATGTATTTAGCTGAAGATTATTTTAGGAAACATAAAATCCGTTCTAACGCTAATGTGATATATGCAACGCCAAAAGATGCTTTATTTGACGTAGGAAAATATAATAAAGAATTAGAAAGGATTGTTGAAGAAAGAAATATAACAGTCAATTATAATTATAACCTTGTTGAAATCGACGGTGACAAAAAAGTGGCTACATTCGAACATATCAAAGCATACGATAGAAAAACAATAAGTTATGATATGTTACATGTAACACCACCTATGGGTCCCTTAGATGTAGTAAAAGAAAGTACACTTTCAGATAGTGAGGGTTGGGTAGATGTTAACCCAACCACATTACAGCATAAAAGCTACTCTAATGTATTTGCACTTGGTGATGCTTCAAATGTACCTACTTCAAAAACAGGCGCAGCTATTCGTAAGCAAGCACCTATCGTCGCTAATAATTTATTGCAAGTGATGAATAATCAAATGTTAACGCATCATTATGATGGTTATACTTCATGCCCTATTGTTACTGGATATAATAGGTTAATACTTGCAGAGTTTGATTATAATAAAAATACTAAAGAAACAATGCCGTTTAATCAGGCCAAAGAACGTAGAAGTATGTATATATTTAAGAAAGATTTATTACCTAAAATGTATTGGTACGGCATGCTAAAAGGATTAATATAA
hypothetical protein4009.2353945228.4-0.404pyridine nucleotide-disulfide oxidoreductase family proteinTIGR0316961.6Sulfide:quinone oxidoreductase, Type IIPF07992Pyr_redox_2Pyridine nucleotide-disulphide oxidoreductaseCL0063NADP_Rossmann60no significant predictionIntracellularno predicted signal peptide0151220241A0A0H3K663YP_001331064
MEKMNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYYQPLWTLVGAGVSSLKSSRKDMESVIPEGANWIKQAVSSFQPENNSVILGDNTVVYYDFLVVAPGLQINWSSIKGLKENIGKNGVCSNYSPDYVNETWNQISNFKQGNAIFTHPNTPIKCGGAPMKIMYLAEDYFRKHKIRSNANVIYATPKDALFDVGKYNKELERIVEERNITVNYNYNLVEIDGDKKVATFEHIKAYDRKTISYDMLHVTPPMGPLDVVKESTLSDSEGWVDVNPTTLQHKSYSNVFALGDASNVPTSKTGAAIRKQAPIVANNLLQVMNNQMLTHHYDGYTSCPIVTGYNRLILAEFDYNKNTKETMPFNQAKERRSMYIFKKDLLPKMYWYGMLKGLI
no data available MicrobesOnline: NWMN_0027 > NWMN_0028 > NWMN_0029NWMN_197015205410; 26177047
NWMN_0030NWMN_RS00190S. aureus NewmanSAUPAN000382000-CDSNWMN_0030hypothetical proteinchromosome-4268243668987unknown5329935YP_0013310653705561
ATGAAAGAAAATTTTTGGAGTGAATTACCACGTCCATTTTTTATTTTGGCGCCAATGGAAGACGTTACAGATATCGTCTTTCGACACGTTGTAAGTGAAGCAGCTAGACCGGATGTGTTTTTCACTGAATTTACAAATACTGAAAGCTTTTGCCACCCTGAAGGCATACATAGTGTGCGCGGACGCTTAACTTTTAGTGAAGATGAACAGCCGATGGTCGCTCATATATGGGGAGATAAGCCAGAACAGTTCCGTGAAACGAGTATTCAATTAGCTAAAATGGGCTTTAAAGGCATAGACTTAAATATGGGATGTCCTGTAGCAAATGTTGCTAAAAAGGGTAAGGGTTCCGGCTTAATCTTAAGACCTGACGTTGCTGCCGAAATTATTCAAGCGACTAAAGCAGGTGGGCTTCCGGTAAGTGTTAAAACACGCCTTGGCTACTATGAAATCGATGAATGGAAAGATTGGTTGAAGCACGTCTTCGAACAAGACATTGCCAATTTATCTATTCATCTTCGTACACGTAAAGAAATGAGTAAAGTAGATGCACATTGGGAATTAATCGAAGCTATTAAAAATTTACGTGACGAAATTGCACCAAATACATTGTTAACAATTAACGGTGATATTCCCGATAGAAAAACAGGACTTGAACTGGCAGAAAAATATGGCATTGATGGCGTCATGATTGGTAGAGGCATTTTCCACAATCCATTCGCTTTTGAAAAAGAACCACGCGAACACACAAGCAAGGAACTATTAGATCTATTGAGATTGCATTTATCATTGTTTAACAAATATGAAAAAGATGAAATACGACAATTCAAGAGCTTGCGTAGATTCTTTAAAATCTATGTGCGTGGCATAAGAGGCGCTAGCGAACTTCGACATCAATTGATGAACACACAATCAATTGCAGAAGCACGAGCACTACTCGATGAATTTGAAGCCCAAATGGACGAAGACGTTAAAATTGAATTATAG
hypothetical protein3286.1493937767.1-0.375611.3.1.-Unknown functionGeneralputative TIM-barrel protein, nifR3 familyTIGR00737162.1RNA Metabolism / RNA processing and modification / tRNA modification Archaea / tRNA dihydrouridine synthase B (EC 1.-.-.-)PF01207DusDihydrouridine synthase (Dus)CL0036TIM_barrel169.9CytoplasmicIntracellularno predicted signal peptide0151220242A0A0H3KD80YP_001331065
MKENFWSELPRPFFILAPMEDVTDIVFRHVVSEAARPDVFFTEFTNTESFCHPEGIHSVRGRLTFSEDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLILRPDVAAEIIQATKAGGLPVSVKTRLGYYEIDEWKDWLKHVFEQDIANLSIHLRTRKEMSKVDAHWELIEAIKNLRDEIAPNTLLTINGDIPDRKTGLELAEKYGIDGVMIGRGIFHNPFAFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQLMNTQSIAEARALLDEFEAQMDEDVKIEL
no data available
NWMN_0031NWMN_RS00200S. aureus NewmanSAUPAN000384000-CDSNWMN_0031hypothetical proteinchromosome+4422944525297unknown5329936YP_0013310663705562
ATGGCGACTAAGAAAGATGTACATGATTTATTTTTAAATCATGTGAATTCAAACGCGGTTAAGACAAGAAAGATGATGGGAGAATATATTATTTATTATGATGGCGTGGTTATAGGTGGTTTGTATGATAATAGATTATTGGTCAAGGCGACTAAAAGTGCCCAGCAGAAATTGCAAGATAATACATTAGTTTCGCCATATCCAGGTTCTAAAGAAATGATATTAATTCTAGACTTTACCGAAGCAACAAATCTCACTGATTTATTTAAGACCATAAAAAATGATTTGAAAAAGTGA
hypothetical protein989.6445211138.9-0.297959FIG01108183: hypothetical proteinPF04993TfoX_NTfoX N-terminal domainCL0631YgaC_TfoX-N37.4no significant predictionIntracellularno predicted signal peptide0151220243A0A0H3K5H9YP_001331066
MATKKDVHDLFLNHVNSNAVKTRKMMGEYIIYYDGVVIGGLYDNRLLVKATKSAQQKLQDNTLVSPYPGSKEMILILDFTEATNLTDLFKTIKNDLKK
no data available
NWMN_0032NWMN_RS00205S. aureus NewmanSAUPAN000385000-CDSNWMN_0032hypothetical proteinchromosome-44597458171221unknown5329937YP_0013310673705563
ATGACTGATTTGTTGAAAATTAAAAACTTCAGATTGTTCTTTTTAGCAGAAATAATTTCAGCATTCGGAGTTGGAATTAGTACAGTTGGGGCTAATTGGTATTTAATCGACAAAACTAACGACTCCCAACTATTAGGTATTATGTTAGCTTTAAATGTATTATCCGGTTTCTTAGCTTCTCCTATAATAGGTGGACTAGCCGATAAATATAATAGACGAAATATTATTTTAATCACCTATCTTCTTCAGGTAATATTATATTTACTCATTGTCATAGCACTCGTAATGATAGGATTTGAGACCTATTTAGTGATTGGATTTGCGATTGTTAATGGGATAGGTTGGACTACGTATATGGCAACATCTAGAAGTTTAGTTAAACAGATATTAAAACCAGATCAATATACAGATGCAAATTCTCTATTAGAGATTAGTTTGCAAACAGGTATGTTTATTGCAGGTGGATTATCAGGAATATTATATAAAATAAATGGATTCACTCTAATTATAGCGATGACTATAATGATGTTTCTAATCAGCATTTTTATGTTATTTAGATTGCATGTAGATAAACCAACTCATTCAGAGGAAGAATCAACAAATAGCTTATTGCAAGAATATTTATTAGGATGGAAATTTTTAAAAGACAACATGATGATATTTATTTTTGGAGTTATTTCAATCATACCAATGGTGTTTACAATGATCTTTAACATATCATTACCAGGATATGTTTATAATGTTTTAAAACTTTCGTCTGTACAATTTGGTTTTTCAGATATGTTATATGGCATTGGAGGATTATGTGCAGGTTTAATTTCAGCTATTCTTTCGAAGAAAATCTCAACTAAAGTATTGATATTTTTGTTATATTTCATATTAGTCATAAATTCAGCACTATTTATTTGGATAAACTCAGCATTTTACTTATTCATAGGATCATTTATACTAGGCTACTCAATTTCATCAATCAGAATTTATATGAATACAGCTATAATGAACACTGTTTCAGATAAATATGTCGGTCGCTCATTTACGATATGGACGTCAATTTCATTGTTACTGCAAAGTTTAATTGCTCCATTTTTAGGAAGATGGATTAATGAAATTAATGATAAATTCGGTTTCTATATTATACTCATTTTATCCTTACTCATATTTGTTACACTGCTGCTTGTTAACAAAACAGACAAAATAAAATATGCACATAAAGAAGAGTGA
hypothetical protein4069.4375745716.50.86798MetabolismTransport and binding proteinsCations and iron carrying compoundsH+ Antiporter proteinTIGR00900165.1FIG01108443: hypothetical proteinPF07690MFS_1Major Facilitator SuperfamilyCL0015MFS109Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide12151220244A0A0H3K614YP_001331067
MTDLLKIKNFRLFFLAEIISAFGVGISTVGANWYLIDKTNDSQLLGIMLALNVLSGFLASPIIGGLADKYNRRNIILITYLLQVILYLLIVIALVMIGFETYLVIGFAIVNGIGWTTYMATSRSLVKQILKPDQYTDANSLLEISLQTGMFIAGGLSGILYKINGFTLIIAMTIMMFLISIFMLFRLHVDKPTHSEEESTNSLLQEYLLGWKFLKDNMMIFIFGVISIIPMVFTMIFNISLPGYVYNVLKLSSVQFGFSDMLYGIGGLCAGLISAILSKKISTKVLIFLLYFILVINSALFIWINSAFYLFIGSFILGYSISSIRIYMNTAIMNTVSDKYVGRSFTIWTSISLLLQSLIAPFLGRWINEINDKFGFYIILILSLLIFVTLLLVNKTDKIKYAHKEE
no data available
NWMN_0033S. aureus NewmanSAUPAN000843000-CDSNWMN_0033hypothetical proteinchromosome+4558245884303unknown5329938YP_0013310683705564
GTGATTAAAATAATATTTCGTCTATTATATTTATCGGCTAGTCCACCTATTATAGGAGAAGCTAAGAAACCGGATAATACATTTAAAGCTAACATAATACCTAATAGTTGGGAGTCGTTAGTTTTGTCGATTAAATACCAATTAGCCCCAACTGTACTAATTCCAACTCCGAATGCTGAAATTATTTCTGCTAAAAAGAACAATCTGAAGTTTTTAATTTTCAACAAATCAGTCATAAATATCACCTTTTTTCAATGCAAGATTTATATTTGCGAGCTCTTCTATAAATTGAGAGTCGTTTAA
hypothetical protein10010.291711475.80.416no significant predictionIntracellularno predicted signal peptide0151220245A0A0H3K9V6YP_001331068
MIKIIFRLLYLSASPPIIGEAKKPDNTFKANIIPNSWESLVLSIKYQLAPTVLIPTPNAEIISAKKNNLKFLIFNKSVINITFFQCKIYICELFYKLRVV
no data available
NWMN_0034NWMN_RS00210S. aureus NewmanSAUPAN000386000-CDSNWMN_0034hypothetical proteinchromosome-4581046295486unknown5329939YP_0013310693705565
TTGAAGAATTTAAAAGTCAACTTTGTGAATTTATATCAAAGCAACATTGAAAAGGTTACAGATAATCGTCATAGCAAAGGTGCCAACTTTCATAATGATGATTACGAACAAATTTTAATCAAAGTTTTAGAATCAGATATTATTATTTTTTCAACACCACTCTATTGGTACTCCATGAGTGCGTCTTTAAAACTCTTCATTGATAGATGGACCGAGTCATTGCGAGATACGCAAATAGACAACTTCAAAGAAATCATGTCACAAAAAAAGTATTTGATTTTAATCATAGGTGGCGACAATCCGCATACCAAAGCACAACCTTTAGTCAACCAATTCAAATTAATATTTGAGTTTATGAATATTACTAACTATAGATTTTTGATCGGCGAAGGCAATAAACCATTCGATATTTTAAACGACTCTCAATTTATAGAAGAGCTCGCAAATATAAATCTTGCATTGAAAAAAGGTGATATTTATGACTGA
hypothetical protein1615.7020318905.5-0.308075MetabolismCentral intermediary metabolismSulfur metabolismFMN reductaseTIGR0356718.5Trp repressor binding proteinPF02525Flavodoxin_2Flavodoxin-like foldCL0042Flavoprotein60.5no significant predictionIntracellularno predicted signal peptide0151220246A0A0H3K669YP_001331069
MKNLKVNFVNLYQSNIEKVTDNRHSKGANFHNDDYEQILIKVLESDIIIFSTPLYWYSMSASLKLFIDRWTESLRDTQIDNFKEIMSQKKYLILIIGGDNPHTKAQPLVNQFKLIFEFMNITNYRFLIGEGNKPFDILNDSQFIEELANINLALKKGDIYD
no data available
NWMN_0035NWMN_RS00215S. aureus NewmanSAUPAN000387000-CDSNWMN_0035LysR family regulatory proteinchromosome+4647347333861unknown5329940YP_0013310703705566
TTGAACTTAAACATTTTAAAATCATTTTTAGTAACTAGTGAAACAAAGAACCTTACTAAAGCATCAGAGTTACTTAACTATTCACAGTCAACTGTATCTACACATATTGAAAAATTAGAAAGGCAATTAGATGTTAAATTATTTTATAGAAAAAAATATGGTATGGAACTAACGGAAGAAGGCTTAGCATACGTTAAATACGCTAAAGTGATTTTAGATAGTAATAGCGAATACGAGAGAGAAATAAAAGGACTTTACAATAAGAAGGTAAATATAAGTATTAACATGCAAGAAAGTCAGTATTTGTATCGCTACTATAATAAGATTAGTGAATGGTTAGCTGAACACCCATATGTAAACTTGAAGTTTAAATCCGCACATTCTAATTTCTATATTAAAGAAGAAATTGCTAATTTCAAATCGGATATTAGCCTTATCACAGACGAAAAGATTATTAATAGTAACTTAACTGCTATTCCTATAACTGAAGAACGTTTAATATTTGTTACTAACAAAGAGATGAAAGATTTCAAATTAAACGATATTCAAAACCATACATTACTTGTTACTGAAAAAGGGTGTAGTTACAGAGAACAGTTAGAAATGATTTTATATAAATATAGCTTTTCAACAAAACAAATGATTGAATTTCTAGGAATTGAGTCATTAAAAAAACACTTGAAAAATTCAGGTGGGATTGCGCTATTGCCGGAATTTATTGTTGCAGATGAATTAGAAAATAAAAGTTTGTTTCAAATAGACGTAGATGTCGATATTCCGAATTTAGAAACAACATTGATAATTAATCCTGAATCGAATAAGCAAGTACTTGAATCTTTTGTAAAAGATGTTTTTTTATAA
LysR family regulatory protein2865.7674933410.2-0.331119Signal transductionRegulatory functionsDNA interactionsaminoethylphosphonate catabolism associated LysR family transcriptional regulatorTIGR0333982.8LysR-family regulatory proteinPF00126HTH_1Bacterial regulatory helix-turn-helix protein, lysR familyCL0123HTH60.8CytoplasmicIntracellularno predicted signal peptide0151220247A0A0H3KD85YP_001331070
MNLNILKSFLVTSETKNLTKASELLNYSQSTVSTHIEKLERQLDVKLFYRKKYGMELTEEGLAYVKYAKVILDSNSEYEREIKGLYNKKVNISINMQESQYLYRYYNKISEWLAEHPYVNLKFKSAHSNFYIKEEIANFKSDISLITDEKIINSNLTAIPITEERLIFVTNKEMKDFKLNDIQNHTLLVTEKGCSYREQLEMILYKYSFSTKQMIEFLGIESLKKHLKNSGGIALLPEFIVADELENKSLFQIDVDVDIPNLETTLIINPESNKQVLESFVKDVFL
no data available
NWMN_0036NWMN_RS00220S. aureus NewmanSAUPAN000846000-CDSNWMN_0036hypothetical proteinchromosome-4768848221534unknown5329941YP_0013310713705567
ATGCATGCAATGCAATATCATGTTAAGTTGCCTAGTGATTACAATATGGAAATAATTAGAGATAGAGTTCGATTAAATGGTTATAAGACTGATGGATTTAAAAATTTAATTATAAAAGCTTATTTAATAAGTCAAACAACTACTAATTGCATTACAAATACTTATTCACCATTATATTTATGGAGAAGTTCAGAGGGGATGACTGAATTTATATTCAATGGATTTTATGATAATGTTATTTCTTCTTTTGGATGGCAAAATATAAATATTGGTGTGATATATTCAATGAACATAACCGATTCTGTTAAACATAGTCTTTATGCGCTTGAAGAATATATCGACATTTTCCCTACTTTATCTCTAAAAGAAATAGAAATCAAAAAATTGTTTAGAATCTTCGATAATGCAGTTGCAGAAATTATAATTTATAATCCTGATAAGTGGAAGTTTGTGAAATATTCATTTATTGAAAATCTTCCAAAGAGTCTCAATCCAAATATAAAAATTTATGATGTACTATATATCTCACAATGA
hypothetical protein1777.5709620874.9-0.10678FIG01108949: hypothetical proteinPF16157DUF4865Domain of unknown function (DUF4865)no clan definedno clan defined203.4CytoplasmicIntracellularno predicted signal peptide0151220248A0A0H3K5I2YP_001331071
MHAMQYHVKLPSDYNMEIIRDRVRLNGYKTDGFKNLIIKAYLISQTTTNCITNTYSPLYLWRSSEGMTEFIFNGFYDNVISSFGWQNINIGVIYSMNITDSVKHSLYALEEYIDIFPTLSLKEIEIKKLFRIFDNAVAEIIIYNPDKWKFVKYSFIENLPKSLNPNIKIYDVLYISQ
no data available
NWMN_0037NWMN_RS00225S. aureus NewmanSAUPAN000670000-CDSNWMN_0037hypothetical proteinchromosome+4831249055744unknown5329942YP_0013310723705568
GTGATTAAATTGAACTTTAATGATTTGGAAATTTTTATAACTGTATGTGAAGAAGCATCTATCAATAAAGCTGCAATTAAACTTAGATATGCACAATCTAATATATCTCAAAGAATTAGCAAGCTTGAAAATGAATTAGGTGTAGTTTTGCTTTTTAGAAATCAAAAAGGTGCTAAGGCAACTAAAGCAGGCGAAGAATTCTTAGCGTATAGCAAAAAAGTATTAAGAGATACAGAGACTATAAAAAATAAAATGAAAAATAATACTATGTCTATTTTATGCTCAGAACTGTTATTTAATTATTTATCTGAGAGCGAAGAAATTATGATGTCGAATAACTCAATTAATTTTATTTCTAGTGGAAATATTAGAAAAGCTATAGAAAAAAATAATTATGATAAGGTTATTTCATTCATAAAAATTAACGACTCAAATTATAGACTTAGTAATGTTGATACTATGAAAGTAACGCTTTACAGTAATGGAAGTAATTATGATAAAGAGGCTTTACTAATAAATAAAGATGAGTTTTGTCCTTTAAGGAAAATAACTTTAGATAATAAGCTTGATTCACAACGGGTAATGGAAATTGATTCATTGGCAGCAATAATAAACTTAGTTAAACAAGGAAAAGGAAAGGCTTTATTACCTATGACTTTTGAGAATAAAAGAGATATAGTACAGGACATTTCTAAGATATTTGAAGTTAACTACTATACTTATAATCATATTATGCATCATTAA
hypothetical protein2479.1893228421.6-0.3417Genetic information processing; Signal transduction; Cellular processesDNA metabolism; Regulatory functions; Cellular processesDNA replication, recombination, and repair; DNA interactions; Toxin production and resistancetranscriptional regulator, ArgP familyTIGR0329850.2LysR-family regulatory proteinPF00126HTH_1Bacterial regulatory helix-turn-helix protein, lysR familyCL0123HTH59.6CytoplasmicIntracellularno predicted signal peptide0151220249A0A0H3K618YP_001331072
MIKLNFNDLEIFITVCEEASINKAAIKLRYAQSNISQRISKLENELGVVLLFRNQKGAKATKAGEEFLAYSKKVLRDTETIKNKMKNNTMSILCSELLFNYLSESEEIMMSNNSINFISSGNIRKAIEKNNYDKVISFIKINDSNYRLSNVDTMKVTLYSNGSNYDKEALLINKDEFCPLRKITLDNKLDSQRVMEIDSLAAIINLVKQGKGKALLPMTFENKRDIVQDISKIFEVNYYTYNHIMHH
no data available no polycistronic organisation predicted
NWMN_0038NWMN_RS00230S. aureus NewmanSAUPAN000148000-CDSNWMN_0038hypothetical proteinchromosome+4948950091603unknown5329943YP_0013310733705569
ATGTTAATTAGTCTTGTAATCCCAGTTTTTGCTTTGTTAGTTATTGGTGGTATTATTTGGATGATTATAGAAGGTATAGTACATATTTCAAAAAAGAATAAAGCAATTGATAACTTTTTTAACCAAGTTAATAAAGTAAGTGAGACATATAAATTCGCTACTACTTTTTTATTTCTAATCTTGGCTACGGCTGGTATTTCTCAATTTTATCTATATTATATAGTATCAGCGTTTCTTTTTTGGCTTGTCATACTTACCTTTGGCATTGCAGGTATCATTTTTTTAATGCCATATGGATTATGTTTTCTACCGTTTTATAAGCAAAAAAAGAAAAAACAGACATTTAAAAAATACATGGTTTACACTACGATTGGTTTGTCAATTTGTCTAGGCTTATCTCTAGTTTTGGTTCACACTACGAAAATTTATATGGACGAAGGTGGCGTAAGATACTATTACGGTAGTTTTGTAATGAAACAAGCGGGCGGTTATGCTTATTTAGCTTTAGCGGTACTTTCAACGTTGTTAATTGTTGCGAAAAAAGCTACAAATAAAAATAAAGAAATCGAAACCGTCGACAATACAAATATAACGGAAAGATAA
hypothetical protein2009.9559522662.10.665integral membrane proteinTIGR0456112.7FIG01108477: hypothetical proteinPF05154TM2TM2 domainno clan definedno clan defined14.1Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide5151220250A0A0H3K9W3YP_001331073
MLISLVIPVFALLVIGGIIWMIIEGIVHISKKNKAIDNFFNQVNKVSETYKFATTFLFLILATAGISQFYLYYIVSAFLFWLVILTFGIAGIIFLMPYGLCFLPFYKQKKKKQTFKKYMVYTTIGLSICLGLSLVLVHTTKIYMDEGGVRYYYGSFVMKQAGGYAYLALAVLSTLLIVAKKATNKNKEIETVDNTNITER
no data available no polycistronic organisation predicted
NWMN_0039NWMN_RS00235S. aureus NewmanSAUPAN000849000-CDSNWMN_0039hypothetical proteinchromosome+50358535103153unknown5329944YP_0013310743705570
ATGAGTCAATTGCTAAATGATACGTTATCGGCTTGGTTGTTAATTGAATCTTTAAGTCCAGGAGAAGTAAATTTTACAGCGGAAGATATACTCTCAGCTGAACATTTTAAAAATGGTGCAAAGCAAGCACAACTTCAAAGTTTTGATGAATATTTTGAAATATGGAATGCTGAACGCTTTATTATATCAGAAGAAAAATCAGAGACTGGGGAACTTATATTTAAATTTTATAGACATTGCTTCCGCTATAATGAAATTAATTTGAAAATTCAGGATATTTTTGATGATTATTCTGAGATTCATAATCCAAATGGGACACACTGTTATGGTTACACATTTAACACAGATAAACACGGCAAAGTGATAGTTGATTCTATACATATTCCGATGATTATGAGTGCATTAAAAGAAATTGAAAAGAACAAAAATGCCAATATAGAAGAAAAATTTAATGATTCTGTTGAAAAATTTGTTCAAAAAGTAAAAGAAATTTTAGCAGATGAACCAATTAATGAATTTAAATTGAAGAAGATGGACAAAGCTTATGATGAGTACTTTTCTGTATTAAATTCAAAGAAAGATGGATTATTTGGACATTATGTAGCAATAGAATATGTGAAAGATAGTGATTTACCACAGCCGGAATTTAACAGCTTCTTCATAAGTGATATTGAGAAAGCAAGAAAATCTCCCAACCAAACTTTAATTGATTACATTGAAGGTGTAGAAGAAAGTCAGCGCATAGAAGTAGATGAAAATAAAGAAATGTTTGACAAATTTTTACATCCTTCACGTTTGCCTGATGGACGATGGCCATCACAGACTGAGTTTAGATTGTCTTTAATGCAACAACTTGCTGTAAACCAAATTACGAGTGGTAATGAAAGAATAAGTTCAGTTAATGGGCCACCAGGTACAGGTAAGACTACTTTATTAAAAGATATATTTGCTCATCTAGTAGTTGAAAGAGGTAAAGAGTTAGCTAAACTAAATAATCCTAAAGATGCATTTGTCAAAACAAAAATTCATGAAACGGATGATAAATACGTATACTTACTAAAGGAATCTATTGCCAAATATAAGATGGTAGTCGCATCTAGTAATAATGGAGCTGTTGAAAATATATCTAAAGATTTACCGAAAATTGAAGAAATTATAAGAAATCCCGAAAAATGTAAATTCCCTAAATATGAACAGAATTATGCAAATTTAGCACATGAATTAAAAGATTTTGCTGAAATAGCTGAAGATTTGATTGGTGAAAGTGCCTGGGGCTTATTTTCTGGAGTTTTTGGTAAAAGTACTAATATTAACCAAGTATTGAGTCATATGTTAAAACAAGATGCGAATGATATTGGCTTTGCTAAATTACTACAAAATGAGAATAATCGTATGAGTTATAACGAGTTAATGAGTGAATGGCAATCACATCAACGTGCATTTTTAGAAGAGTTGAGGCATGTTGAAATGTTAAAAGAAGAATCTATTAGAGCATATGATGTTTATAAAAATTGTGAGTCTTTCTCTAAGATTGAACAGGTTATTAATAGTGAAAAAACAAGTATTGAAGAACAGGTATATCATTTAGATAATGAAACGTTACGAGACAATAAAGAAATAGAAGATTTGGATAATCGAATTAATTATATTGTTAAGCAAATAGAAACTTTAAATGAGTTAATTAAATCCATCAAAGAAAGCAACAAAGGTTTTATTAACAAACTGAAAGCGATGTTTAATTCAGAAGAAGATGAAAGCTATAAAGATCATAATAAAGAGAAGCAACAATTATTAACACAACAGTTAGAGTTAGAGAAATGTAAAAAAAACAAACATGAAGACCTTGTTAGCAAACTAAAAGAAAAAGAGAAATTAATTAAACAATTAACTAAAGTACAGTTGCAATTAGACGAGTTAAATTCACAGTTACAAGAGTTAGAAGCATATCGTATTGAGTCAAAAATTACAATTCCAGAAAAAGATTTTTGGAGTGACAACAATTATGATGAGCGCCAAGTTACTAATCTGTGGACGAGTGACGAACTTCAATACAGACGTGCCATGCTCTTTTTAAGAGCAATGATATTGCATAAATTATTATTGATTGCTAATAATACAACTATTTATTATGCGATTAATGATTTTAAAGATAGAAGGAAATTAATTGATGCAAATCCAGATAAAGTACACAACGCATGGAATGTGATGCATTTAATATTTCCAGTAGTTAGTACGACGTTTGCAAGCTTTAAATCTATGTATGGGGGCATACCAAAAGATTTCATAGACTACTTATTTATTGATGAAGCAGGACAAGCAATACCTCAAGCAGCTGTGGGAGCATTATATCGTTCAAAAAAAGTTGTAGCTGTAGGTGATCCGATTCAAATAGAACCGGTTGTGACTTTAGAAAGTCATTTAATTGATAACATTCGTAAAAATTATCATGTTCCGGAATATCTAGTTTCTAAAGAAGCTTCTGTGCAGTCTGTTGCAGACAACGCCAATCAATATGGTTTTTGGAAATCTGATGCTACTGATAGTAATCAAAAAACCTGGATAGGCATACCTTTATGGGTGCACAGACGATGTTTAAAACCTATGTTCACGATAGCTAACCAAATCGCTTATAATAATAAAATGGTGTTGCCAAGTAATATTACAAAAGTAGGTAAAACAGGTTGGTATGACGTTAAAGGAAACGCAGTTCAAAAACAATTTGTGAAAGAGCATGGTGAAAAAGTAGTGGGATTATTAGCTGATGATTGGATTGAAGCAATTAAGGAAGGTAAAAATGAACCGAGCTCATTTGTAATATCGCCTTTTTCAGCAGTACAGCAACAGATTAAACGTATGTTAAAGCAACAACTACCGACTAGAATTGATATTGAACGTACAAAAATTAATCAATGGGTCGATAAATCCATTGGTACTGTTCATACTTTTCAAGGTAAAGAGGCTCAGAAGGTGTATTTTGTAATAGGTACTGATAATACCCAAGATGGTGCTGTGAACTGGTCATGCGAAAAACCAAACTTGTTAAACGTTGCAGTGACAAGAGCTAAGAAAGAGTTTTATGTAATTGGCGACATGCAAAGAATACAGATGAAACCATTTTATGAGACGATTTTTAAAGAAAGAAATGTAAAATAA
hypothetical protein10506.04559121729-0.569809Genetic information processingDNA metabolismDNA replication, recombination, and repairputative DNA helicaseTIGR0037637.5Superfamily I DNA/RNA helicase proteinPF01443Viral_helicase1Viral (Superfamily 1) RNA helicaseCL0023P-loop_NTPase56.7no significant predictionIntracellularno predicted signal peptide0151220251A0A0H3K673YP_001331074
MSQLLNDTLSAWLLIESLSPGEVNFTAEDILSAEHFKNGAKQAQLQSFDEYFEIWNAERFIISEEKSETGELIFKFYRHCFRYNEINLKIQDIFDDYSEIHNPNGTHCYGYTFNTDKHGKVIVDSIHIPMIMSALKEIEKNKNANIEEKFNDSVEKFVQKVKEILADEPINEFKLKKMDKAYDEYFSVLNSKKDGLFGHYVAIEYVKDSDLPQPEFNSFFISDIEKARKSPNQTLIDYIEGVEESQRIEVDENKEMFDKFLHPSRLPDGRWPSQTEFRLSLMQQLAVNQITSGNERISSVNGPPGTGKTTLLKDIFAHLVVERGKELAKLNNPKDAFVKTKIHETDDKYVYLLKESIAKYKMVVASSNNGAVENISKDLPKIEEIIRNPEKCKFPKYEQNYANLAHELKDFAEIAEDLIGESAWGLFSGVFGKSTNINQVLSHMLKQDANDIGFAKLLQNENNRMSYNELMSEWQSHQRAFLEELRHVEMLKEESIRAYDVYKNCESFSKIEQVINSEKTSIEEQVYHLDNETLRDNKEIEDLDNRINYIVKQIETLNELIKSIKESNKGFINKLKAMFNSEEDESYKDHNKEKQQLLTQQLELEKCKKNKHEDLVSKLKEKEKLIKQLTKVQLQLDELNSQLQELEAYRIESKITIPEKDFWSDNNYDERQVTNLWTSDELQYRRAMLFLRAMILHKLLLIANNTTIYYAINDFKDRRKLIDANPDKVHNAWNVMHLIFPVVSTTFASFKSMYGGIPKDFIDYLFIDEAGQAIPQAAVGALYRSKKVVAVGDPIQIEPVVTLESHLIDNIRKNYHVPEYLVSKEASVQSVADNANQYGFWKSDATDSNQKTWIGIPLWVHRRCLKPMFTIANQIAYNNKMVLPSNITKVGKTGWYDVKGNAVQKQFVKEHGEKVVGLLADDWIEAIKEGKNEPSSFVISPFSAVQQQIKRMLKQQLPTRIDIERTKINQWVDKSIGTVHTFQGKEAQKVYFVIGTDNTQDGAVNWSCEKPNLLNVAVTRAKKEFYVIGDMQRIQMKPFYETIFKERNVK
no data available no polycistronic organisation predicted
NWMN_0040NWMN_RS00240S. aureus NewmanSAUPAN000853000-CDSNWMN_0040hypothetical proteinchromosome+5356754049483unknown5329945YP_0013310753705571
ATGGAGAAATTTAACAACTGGATATTAAATGCAATAAGTGGATCTCAAACAGACAAGAATGAAACAACTGAAGAATTAAAAGGGGCAAAATTTATCATTTTATATGCATATTCAATGCTCGTTTTGCTTGCGTTAGTAATTTCTAACATATTCATTCACATTTTGGAGCCTAAACTATCAATCACCACTCAAATCATCATCGTTTTGATTTTAATTGAAGCACTAATTGGACTGCGTTTCTTGAAAGCGTACGATGTTAAGCGTGGCAAAGATAAAGAAAATAAGAAAAATAGTAAGGATTTCGTTAAACTAAAATCAATTTTAGTAGCAATTTTATTTACATCATTGGCGCTGACAGCAGGTACTGTAGCTGATATATACGGTTTCACTGACTTAGGAAATACTAGAAGTGATTTAATCGTTTGGAGCATAGGTGGTATTATATTTGGCCTCGTATGTTACACAATGGAAGATAAAAGATAA
hypothetical protein1609.3513817920.10.429375Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesoligosaccharide repeat unit polymeraseTIGR0437016.8FIG01108341: hypothetical proteinPF09323DUF1980Domain of unknown function (DUF1980)no clan definedno clan defined17.8Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide4151220252A0A0H3KD93YP_001331075
MEKFNNWILNAISGSQTDKNETTEELKGAKFIILYAYSMLVLLALVISNIFIHILEPKLSITTQIIIVLILIEALIGLRFLKAYDVKRGKDKENKKNSKDFVKLKSILVAILFTSLALTAGTVADIYGFTDLGNTRSDLIVWSIGGIIFGLVCYTMEDKR
no data available no polycistronic organisation predicted
NWMN_0041NWMN_RS00245S. aureus NewmanSAUPAN000858000plcCDSNWMN_0041hypothetical proteinchromosome+5425455240987unknown5329946YP_0013310763705572
ATGAAAAAGTGTATTAAGACTTTGTTTTTAAGTATCATTTTAGTAGTGATGAGTGGTTGGTATCATTCAGCACATGCGTCAGATTCGTTGAGTAAAAGTCCAGAAAATTGGATGAGTAAACTTGATGATGGAAAACATTTAACTGAGATTAATATACCGGGTTCACATGATAGTGGCTCATTCACTTTAAAGGATCCAGTAAAATCAGTTTGGGCAAAGACTCAAGATAAAGATTACCTTACCCAAATGAAGTCGGGAGTCAGGTTTTTTGATATTAGAGGTAGAGCAAGTGCTGATAATATGATTTCAGTTCATCACGGCATGGTTTATTTGCATCATGAATTAGGAAAATTTCTCGATGATGCTAAATATTACTTGAGTGCTTATCCAAACGAAACAATTGTGATGTCTATGAAAAAGGACTACGATAGCGATTCTAAAGTTACGAAGACATTTGAAGAAATTTTTAGAGAATATTATTATAATAACCCGCAATATCAGAATCTTTTTTACACAGGAAGTAATGCGAATCCTACTTTAAAAGAAACGAAAGGTAAAATTGTCCTATTCAATAGAATGGGGGGTACGTACATAAAAAGTGGTTATGGTGCTGACACGTCAGGTATTCAATGGGCAGACAATGCGACATTTGAAACGAAAATTAATAATGGTAGCTTAAATTTAAAAGTACAAGATGAGTATAAAGATTACTATGATAAAAAAGTTGAAGCTGTTAAAAATTTATTGGCTAAAGCTAAAACGGATAGTAACAAAGACAATGTATATGTGAATTTCTTGAGTGTAGCGTCTGGAGGCAGCGCATTTAATAGTACTTATAACTATGCATCACATATAAATCCTGAAATTGCAAAAACGATTAAAGCAAATGGGAAAGCTAGAACGGGTTGGCTGATTGTTGACTATGCAGGATATACGTGGCCTGGATATGATGATATCGTAAGTGAAATTATAGATAGTAATAAATAA
hypothetical protein3288.6278537086.4-0.5554884.6.1.13Phages, Prophages, Transposable elements, Plasmids / Pathogenicity islands / Listeria Pathogenicity Island LIPI-1 extended / Phosphatidylinositol-specific phospholipase C (EC 4.6.1.13)PF00388PI-PLC-XPhosphatidylinositol-specific phospholipase C, X domainCL0384PLC65.7ExtracellularN-terminally anchored (No CS)signal peptide predicted1151220253P45723YP_001331076
MKKCIKTLFLSIILVVMSGWYHSAHASDSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASHINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNK
no data available no polycistronic organisation predicted
NWMN_0042NWMN_RS00250S. aureus NewmanSAUPAN000860000csa1ACDSNWMN_0042hypothetical proteinchromosome+5546156231771unknown5329947YP_0013310773705573
ATGATGAAACGATTAAACAAATTAGTGTTAGGCATTATTTTTCTGTTTTTAGTCATTAGTATCACTGCTGGTTGTGGCATAGGTAAAGAAGCGGAAGTTAAGAAAAGCTTTGAAAAAACATTGAGTATGTACCCTATTAAAAATCTAGAGGATTTATACGATAAGGAAGGCTATCGTGATGATCAGTTTGATAAAAATGATAAAGGTACATGGATTATAAATTCTGAAATGGTTATTCAACCTAATAATGAAGATATGGTAGCTAAAGGCATGGTTCTATATATGAATAGAAATACCAAAACAACAAATGGTTACTACTATGTCGATGTGACTAAGGACGAGGATGAAGGAAAACCGCACGACAATGAAAAAAGATATCCGGTTAAAATGGTCGATAATAAAATCATTCCAACAAAAGAAATTAAAGATGAAAAAATAAAAAAAGAAATCGAAAACTTTAAGTTCTTTGTTCAATATGGCGACTTTAAAAATTTGAAAAATTATAAAGACGGAGATATTTCATATAATCCAGAGGTGCCGAGTTATTCGGCTAAATATCAATTAACTAATGATGATTATAATGTAAAACAATTACGCAAAAGATATGATATACCGACGAGTAAAGCTCCAAAGTTATTGTTAAAAGGTTCAGGGAATTTAAAAGGCTCATCAGTTGGATATAAAGATATTGAATTTACGTTTGTAGAGAAAAAAGAAGAAAATATATACTTTAGTGATAGCTTAGATTATAAAAAAAGCGGAGATGTATAA
hypothetical protein2568.6528429786.8-0.793359Staphylococcus tandem lipoproteinsTIGR01742381.5FIG01107885: hypothetical proteinPF04507DUF576Csa1 familyCL0048LolA_LolB414.3no significant predictionLipid anchoredno predicted signal peptide1151220254A0A0H3K5I6YP_001331077
MMKRLNKLVLGIIFLFLVISITAGCGIGKEAEVKKSFEKTLSMYPIKNLEDLYDKEGYRDDQFDKNDKGTWIINSEMVIQPNNEDMVAKGMVLYMNRNTKTTNGYYYVDVTKDEDEGKPHDNEKRYPVKMVDNKIIPTKEIKDEKIKKEIENFKFFVQYGDFKNLKNYKDGDISYNPEVPSYSAKYQLTNDDYNVKQLRKRYDIPTSKAPKLLLKGSGNLKGSSVGYKDIEFTFVEKKEENIYFSDSLDYKKSGDV
no data available MicrobesOnline: NWMN_0042 > NWMN_004323895222
NWMN_0043NWMN_RS00255S. aureus NewmanSAUPAN000859000-CDSNWMN_0043hypothetical proteinchromosome+5628357053771unknown5329948YP_0013310783705574
ATGATAAAACGTGTAAATAAATTAGTGCTTGGTATTAGTCTTCTGTTTTTAGTCATTAGTATCACTGCTGGTTGTGGCATGGGTAAAGAAGCGGAAATAAAGAAAAGTTTTGAAAAAACATTGAGTATGTATCCGATTAAAAATCTAGAGGATTTATACGATAAAGAAGGATATCGTGATGATCAATTTGATAAAAATGATAAGGGAACATGGATTGTAAATTCTCAAATGGCAATTCAAAATAAAGGAGAAGCTCTAAAAATAAAAGGCATGCTTTTGAAGATAGATAGAAATACAAGAAGTGCAAAAGGATTTTACTATACTAATGAAATAAAGACGGAGAAATACGAAGTAGCTCAGGATAATCAAAAAAAATATCCAGTTAAAATGATTAATAATAAATTCATTTCTACTGAGGAAGTTAAAGAAGAAAACATAAAAAAAGAAATCGAAAACTTTAAGTTTTTTGCGCAATATAGCAATTTTAAAGATTTAATGAATTATAAAGATGGAGATATATCATATAATCCAGAGGTGCCGAGTTATTCAGCTCAATATCAATTAACTAATGATGATTATAATGTAAAACAATTACGTAAAAGATATGACATACCAACAAATAAAGCGCCGAAGCTGTTGTTGAAAGGTACAGGGAATTTAAAAGGTTCATCAGTTGGATATAAAAAAATTGAATTTACTTTTTTAGAGAATAAAAATGAAAATATTTACTTTACTGATAGTCTACATCTTGAACCGAGCGAGGATAAATAA
hypothetical protein2569.4187829790.8-0.775391Staphylococcus tandem lipoproteinsTIGR01742372.3FIG01107885: hypothetical proteinPF04507DUF576Csa1 familyCL0048LolA_LolB412.7no significant predictionLipid anchoredsignal peptide predicted1151220255A0A0H3K621YP_001331078
MIKRVNKLVLGISLLFLVISITAGCGMGKEAEIKKSFEKTLSMYPIKNLEDLYDKEGYRDDQFDKNDKGTWIVNSQMAIQNKGEALKIKGMLLKIDRNTRSAKGFYYTNEIKTEKYEVAQDNQKKYPVKMINNKFISTEEVKEENIKKEIENFKFFAQYSNFKDLMNYKDGDISYNPEVPSYSAQYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKKIEFTFLENKNENIYFTDSLHLEPSEDK
no data available MicrobesOnline: NWMN_0042 > NWMN_0043
NWMN_0044NWMN_RS00260S. aureus NewmanSAUPAN000862000-CDSNWMN_0044hypothetical proteinchromosome+5711757887771unknown5329949YP_0013310793705575
ATGATGAAACGATTAAACAAATTAGTGTTAGGCATTATTTTTCTGTTTTTAGTCATTAGTATCACTGCTGGTTGTGGCATAGGTAAAGAAGCGAAAATAAAGAAAAGTTTTGAGAAGACATTGAGTATGTATCCGATTAAAAATCTAGAGGATTTATACGATAAAGAAGGTTATCGTGATGACGAATTTGATAAAAATGATAAAGGTACATGGATTATTGGTTCTGAAATGGCAACTCAAAATAAGGGGGAAGCTCTGAAAGTTAAAGGTATGGTCTTGTATATGAATAGAAATACCAAAACAACAAAAGGATATTATTATGTAAATGCAATAAAGAATGATAAAGACGGAAGACCCCAAGAGAATGAAAAAAGGTACCCAGTTAAAATGGTCGATAATAAAATCATTCCAACAAAAGAAATTAAAGATAAAAACATAAAAAAAGAAATCGAAAACTTTAAGTTCTTTGTTCAATATGGAAACTTTAAAGATTTGTCGAAGTATAAAGACGGAGATATTTCATATAATCCAGAGGTGCCGAGTTATTCGGCTAAATATCAATTAACTAATGATGATTACAATGTAAAGCAATTACGTAAAAGATATGACATACCAACAAATAAAGCACCGAAGTTGTTGTTGAAGGGTACAGGGAATTTAAAAGGTTCATCAGTTGGATATAAAGACATTGAATTTACGTTTGTAGAGAAAAAAGAAGAGAACATTTACTTTAGTGATGGGTTAATTTTTAAACCAAGTGAGGATAAATAA
hypothetical protein2569.8345529708-0.783594Staphylococcus tandem lipoproteinsTIGR01742391.4FIG01107885: hypothetical proteinPF04507DUF576Csa1 familyCL0048LolA_LolB427.2no significant predictionLipid anchoredno predicted signal peptide1151220256A0A0H3K9X0YP_001331079
MMKRLNKLVLGIIFLFLVISITAGCGIGKEAKIKKSFEKTLSMYPIKNLEDLYDKEGYRDDEFDKNDKGTWIIGSEMATQNKGEALKVKGMVLYMNRNTKTTKGYYYVNAIKNDKDGRPQENEKRYPVKMVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFKDLSKYKDGDISYNPEVPSYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDIEFTFVEKKEENIYFSDGLIFKPSEDK
no data available no polycistronic organisation predicted
NWMN_0045NWMN_RS00265S. aureus NewmanSAUPAN000861000-CDSNWMN_0045hypothetical proteinchromosome+5795458721768unknown5329950YP_0013310803705576
ATGAAACGATTAAACAAATTGGTATTGTATATTAGTTTTTTGATATTAGTCATTAGTTTCACTGCTGGTTGTGGCATAGGTAAAGAAGCGGAAGTTAAGAAAAGCTTTGAAAAAACATTGAGTATGTATCCGATTAAAAATCTAGAGGATTTATACGATAAAGAAGGTTATCGTGATGACGAATTTGATAAAAATGATAAAGGTACATGGATTATTGGTTCTGAAATGGTTGTTCAACCTAAAGGGGAACGTATGAAATCAAAAGGTATGGTTCTATATATGAATAGAAACACTAAGACTACAACCGGGAAGTATATAGTGAGTGAAACACTTCATGATGAAGATGGTAGACCTAAGAGTAAAGATAAAGAATATCCCGTTAAAATGGTAGACAATAAAATCATTCCAACTAAAGGTATCAAAGACGAAAATATAAAAAAAGAAATCGAGAATTTTAAGTTCTTCGCGCAATATGGCAGCTTTAAAGATTTGTCGAAGTACAAAGACGGCGATATATCATATAATCCAGAGGTACCGAGTTATTCAGCAAAATATCAATTAACTAATGATGACTATAATGTAAAACAATTACGAAAAAGATATAAAATACCAACGAATAAAGCACCAAAGTTATTGTTGAAAGGTTCGGGAGACTTAAAAGGTTCATCAGTTGGATATAAAGACATTGAATTTACTTTTGTGGAGAAAAAAGGTGAAAATACTTTTTTTACTGATAGTCTACATCTTGAACCGAGTGAGGATAAATAA
hypothetical protein2559.5266929399.5-0.8Staphylococcus tandem lipoproteinsTIGR01742423.4FIG01107885: hypothetical proteinPF04507DUF576Csa1 familyCL0048LolA_LolB417.7no significant predictionLipid anchoredno predicted signal peptide1151220257A0A0H3K678YP_001331080
MKRLNKLVLYISFLILVISFTAGCGIGKEAEVKKSFEKTLSMYPIKNLEDLYDKEGYRDDEFDKNDKGTWIIGSEMVVQPKGERMKSKGMVLYMNRNTKTTTGKYIVSETLHDEDGRPKSKDKEYPVKMVDNKIIPTKGIKDENIKKEIENFKFFAQYGSFKDLSKYKDGDISYNPEVPSYSAKYQLTNDDYNVKQLRKRYKIPTNKAPKLLLKGSGDLKGSSVGYKDIEFTFVEKKGENTFFTDSLHLEPSEDK
no data available no polycistronic organisation predicted
NWMN_0046NWMN_RS00270S. aureus NewmanSAUPAN000891000-CDSNWMN_0046hypothetical proteinchromosome+58815610522238unknown5329951YP_0013310813705577
ATGCAACGTGATTATTTAATTCGAGTAGAAACTGAGAGTATGTCAGATTTCAAAAGGCTCAATAGTTTAATGATTGGTTTTGTTATTAAAGGTGAGGCACACATTTATGATGAAAATAATATGACGCAATGCAACAGTGGCGACATTTTCATCATTAACCACCGCGACTTGTATCGATTTCAACTTCAACAAGATGGCATCATATGTTATATCCAATTCCAAATGAAATATTTAGCAGACAAGTTTGATGATGTGCATTGTCTATATTTTCACTTAACAGATGCGACCACAACAAAGAATATACATCAACTGAGAAATATAATGGCAAGACTGGTTTCAACACATATCCGACATAATGAGTTGTCTAAATTGACTGAGCAACAACTTGTGATTCAGTTGCTTATGCATATGATTCATTATGTCCCGCGTACATATCATTCGAACCAAAGTATCTTAAATGATGATAAAGTGAATCAAGTATGCGACTATATCGAGTTACATTTTCATGAAGATTTAAGCCTTTCAGAATTAAGCGAATACGTTGGGTGGTCAGAGAGCCATCTGTCTAAAAAGTTTACAGAATCGCTAGGTGTAGGATTCCATCATTTCTTAAATACGACGCGAATTGAGCATGCGAAACTCGATTTGACATACACAGATGAAACCATTACTGATATTGCATTGCAAAATGGCTTTTCAAGTGCAGCGAGCTTTGCGAGAACATTTAAACACTTTACGCATCAAACACCTAAACAATATCGAGGTGATCGTCCAGCAATCACTGAAAACCAGCAATCGGCACAACATGATTATCACGACCGTGAATTGATATTACTTTTAAATGACTACATTGAAGAAATGAATCATTTTATTGAAGATATTGAAAAGATGAACTATAAAGAGATTGCCTTTCAACCAACCAATCACCAACTAAATCAATTTAATCATATTATTCAAGTGGGCTATTTGAGGAATTTGCTCAATACACAGTATCAATCACAGTTGCTTACATGTCATCATGATTTTCAAGTCAATGAAGTATTAGCATATGATGTGATTCCATATATCATGAAAAAGCTCAATGCGCCATTCACGTATGATGCAGAAATTTCGAATATATTTTATGATATTGATTTGTGTTTAGACTTTTTATTAGATCATAACTTTAGTTTGACCATGCATTTGGATCAGTATGACTCACGTGATTATATCGATGCATTTAAAATTTTTATCCATCACGTTGCCCTGCATGTCAGTCATAGAAAAGATTTGAAGTTCAACTTGTATGTGACGACATTGCACACGTCTTTGATTGAAATGATTGATTATTTTAAAGCATTATTCCCTAATGGTGGCTTGTACATTCACTTAGATCAAGCTACGGAAAGACATCTACCATTATTGAAACGACTTGAGCCACACATCGACCATTTTGTATTTGATGCCAATTCAAATGACGCTGTTGATTTTAATAAAATGAATGATGATGAATTTAAAACCGCGAGTCAAATGATTATTAATAAAACGAATTACCTTATCGACTTAATGCATCGTCATCGCCTAAAGCGTCCACTCATTTTACTCAATTGGAATACATTGACGGGTGATACATTTATTACAAACGGCGAATATTTTAGAGGTGGTATCATCATTGAGCAATTATTAAAATTAAGTTCTAAAGTAGAGGGTATCGGGTATAGGTTGAATTATGATTTGCACGTCAGTCATTGTAAAAATGAACGGGATTATATGAATTCTATTGAACTATTTCATCAATATAATGGAAAACGTCCGGTCTATTTCACGGCATTGCTATTTAATAAATTAACAAGCAATATTTTGTATTCTGATGATACATGTATTGTCACGGGGACTGATTCAAATTTTCAAATATTGTTATATGATGCAAAGCATTTTAATCCGTACTTAGCGTTGGACAATCAAATGAATATGCGTGCGACGGAAATGATTCATTTGAACATTAATGCCCTGGAAGAAGGTATGTATAAGATTAAACATTTTACCTTAGATAAAGAAAATGGTGCGTTATTTAATCTTTGGCGCAAACATCATACGATACATGGCATGGACAAGGACTCTATAGATTACGTTAATCGAATGAGTTTTCCGAAATTAGAAGTATATGATATAGATATCACGGACACACTGGCATTAAACATTAAAATGATTACGAATGGGATTCACTTAATTGAAGTAAAACGTTACCCAAGTTCATAA
hypothetical protein7456.4016187926.4-0.368591YSIRK-targeted surface antigen transcriptional regulatorTIGR0409458.8Transcriptional regulator, AraC familyPF12833HTH_18Helix-turn-helix domainCL0123HTH77.6CytoplasmicIntracellularno predicted signal peptide0151220258A0A0H3KD98YP_001331081
MQRDYLIRVETESMSDFKRLNSLMIGFVIKGEAHIYDENNMTQCNSGDIFIINHRDLYRFQLQQDGIICYIQFQMKYLADKFDDVHCLYFHLTDATTTKNIHQLRNIMARLVSTHIRHNELSKLTEQQLVIQLLMHMIHYVPRTYHSNQSILNDDKVNQVCDYIELHFHEDLSLSELSEYVGWSESHLSKKFTESLGVGFHHFLNTTRIEHAKLDLTYTDETITDIALQNGFSSAASFARTFKHFTHQTPKQYRGDRPAITENQQSAQHDYHDRELILLLNDYIEEMNHFIEDIEKMNYKEIAFQPTNHQLNQFNHIIQVGYLRNLLNTQYQSQLLTCHHDFQVNEVLAYDVIPYIMKKLNAPFTYDAEISNIFYDIDLCLDFLLDHNFSLTMHLDQYDSRDYIDAFKIFIHHVALHVSHRKDLKFNLYVTTLHTSLIEMIDYFKALFPNGGLYIHLDQATERHLPLLKRLEPHIDHFVFDANSNDAVDFNKMNDDEFKTASQMIINKTNYLIDLMHRHRLKRPLILLNWNTLTGDTFITNGEYFRGGIIIEQLLKLSSKVEGIGYRLNYDLHVSHCKNERDYMNSIELFHQYNGKRPVYFTALLFNKLTSNILYSDDTCIVTGTDSNFQILLYDAKHFNPYLALDNQMNMRATEMIHLNINALEEGMYKIKHFTLDKENGALFNLWRKHHTIHGMDKDSIDYVNRMSFPKLEVYDIDITDTLALNIKMITNGIHLIEVKRYPSS
no data available no polycistronic organisation predicted
NWMN_0047NWMN_RS00275S. aureus NewmanSAUPAN000893000-CDSNWMN_0047hypothetical proteinchromosome+61194623811188unknown5329952YP_0013310823705578
ATGAAGGATATGAATCAACAATTAATTGAAACTTTAAAATCTAAAGAAGGCAAAATGATTGAGATCAGACGTTATTTACATCAGCATCCAGAATTATCTTTTCATGAAGATGAAACGGCGAAATACATCGCTGAATTTTACAAAGGTAAAGATGTGGAAGTAGAAACGAATGTCGGACCACGTGGAATTAAAGTAACGATTGATTCAGGGAAACCTGGTAAAACATTAGCAATCCGTGCAGACTTTGACGCATTACCCATTACTGAAGATACAGGATTATCTTTTGCATCACAAAATAAAGGTGTTATGCACGCATGTGGTCACGATGCACATACAGCATACATGCTTGTATTAGCAGAGACGCTTGCTGAAATGAAAGATAGTTTTACAGGAAAAGTCGTTGTGATACATCAACCAGCTGAAGAAGTACCACCAGGTGGTGCTAAAACAATGATTGAAAATGGTGTATTAGACGGTGTTGATCATGTATTAGGTGTACACGTCATGAGCACAATGAAAACAGGTAAAGTGTATTACAGACCTGGTTATGTTCAAACAGGACGCGCATTCTTCAAATTGAAAGTTCAAGGTAAAGGTGGTCATGGTTCATCACCACATATGGCCAATGATGCCATTGTTGCAGGTAGCTACTTCGTCACAGCGTTACAAACAGTTGTATCTAGACGACTAAGTCCATTTGAAACCGGTGTTGTCACAATCGGTTCATTTGACGGTAAAGGTCAATTCAATGTCATTAAAGATGTTGTTGAAATTGAAGGTGATGTACGTGGATTAACAGATGCTACAAAAGCAACAATTGAAAAAGAAATTAAACGTTTATCAAAAGGATTAGAGGATATGTATGGTGTAACTTGCACCTTAGAATATAACGATGATTATCCAGCATTATATAATGATCCAGAGTTTACTGAGTACGTGGCTAAGACGTTGAAAGAAGCAAACCTTGATTTTGGTGTTGAAATGTGTGAACCACAACCACCTTCAGAAGACTTTGCATATTATGCTAAAGAACGCCCAAGTGCCTTTATTTATACAGGTGCAGCGGTGGAAAATGGTGAAATTTACCCACATCATCATCCTAAATTTAACATTTCAGAAAAATCATTACTTATTTCTGCAGAAGCAGTAGGGACAGTTGTTTTAGATTACCTTAAAGGAGATAACTAA
hypothetical protein3955.4405343472-0.322785Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesamidohydrolaseTIGR01891349.9Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit APF01546Peptidase_M20Peptidase family M20/M25/M40CL0035Peptidase_MH109.2CytoplasmicIntracellularno predicted signal peptide0151220259A0A0H3K5J0YP_001331082
MKDMNQQLIETLKSKEGKMIEIRRYLHQHPELSFHEDETAKYIAEFYKGKDVEVETNVGPRGIKVTIDSGKPGKTLAIRADFDALPITEDTGLSFASQNKGVMHACGHDAHTAYMLVLAETLAEMKDSFTGKVVVIHQPAEEVPPGGAKTMIENGVLDGVDHVLGVHVMSTMKTGKVYYRPGYVQTGRAFFKLKVQGKGGHGSSPHMANDAIVAGSYFVTALQTVVSRRLSPFETGVVTIGSFDGKGQFNVIKDVVEIEGDVRGLTDATKATIEKEIKRLSKGLEDMYGVTCTLEYNDDYPALYNDPEFTEYVAKTLKEANLDFGVEMCEPQPPSEDFAYYAKERPSAFIYTGAAVENGEIYPHHHPKFNISEKSLLISAEAVGTVVLDYLKGDN
no data available MicrobesOnline: NWMN_0047 > NWMN_0048NWMN_197015205410; 21725011
NWMN_0048NWMN_RS00280S. aureus NewmanSAUPAN000894000norCCDSNWMN_0048hypothetical proteinchromosome+62383637711389unknown5329953YP_0013310833705579
ATGAATGAAACGTATCGCGGGGGCAACAAGTTAATCTTAGGTATTGTATTAGGTGTTATTACATTTTGGTTGTTTGCACAATCACTTGTAAATGTTGTACCGAATTTACAACAAAGTTTTGGTACAGACATGGGGACAATTAGTATTGCGGTCAGTCTAACTGCACTATTTTCAGGCATGTTTGTTGTTGGAGCAGGTGGTCTGGCAGATAAAATTGGGCGCGTGAAAATGACGAATATCGGTTTATTATTAAGTATTATTGGTTCAGCATTAATTATTATTACGAATTTACCGGCATTATTAATTTTAGGTCGTGTTATACAAGGTGTATCAGCAGCGTGTATTATGCCTTCTACATTGGCCATTATGAAAACTTATTATCAGGGTGCTGAACGTCAGCGTGCCTTAAGTTATTGGTCTATCGGTTCTTGGGGTGGCAGTGGTATCTGTTCACTCTTCGGTGGTGCAGTTGCGACAACTATGGGTTGGAGATGGATTTTCATCTTCTCAATTATCGTTGCCGTACTTTCAATGTTACTCATCAAAGGGACGCCTGAAACGAAATCAGAAATTACCAATACACATAAATTTGACGTTGCAGGGCTAATTGTTCTAGTAGTTATGTTGCTAAGTTTAAACGTTGTCATTACTAAAGGTGCAGCACTTGGTTACACATCATTATGGTTCTTTGGTTTGATTGCAATCGTAATTGTAGCATTCTTTATTTTCTTAAATGTTGAGAAAAAAGTAGATAATCCACTTATTGATTTTAAATTATTTGAAAATAAACCATATACAGGTGCAACGATTTCGAACTTCTTATTAAACGGTGTTGCAGGTACATTAATTGTAGCGAATACATTCGTGCAACAAGGTTTAGGTTATACAGCATTGCAGGCAGGATACTTATCAATTACTTATTTAATCATGGTGTTATTGATGATTCGAGTTGGTGAAAAATTATTACAAAAAATGGGTTCTAAGCGACCAATGTTATTAGGTACATTCATTGTGGTCATTGGTATTGCACTTATTTCATTAGTATTCTTACCAGGCATATTTTATGTTATCAGTTGTGTCGTAGGATATTTATGTTTCGGACTAGGCTTAGGTATTTATGCAACACCTTCTACAGATACAGCTATTTCGAATGCACCGTTAGATAAAGTTGGCGTTGCTTCAGGTATTTATAAAATGGCTTCATCACTTGGTGGCGCATTCGGTGTCGCAATTAGTGGTGCTGTATATGCTGGTGCAGTTGCTGCAACGAGCATTCATACAGGTGCGATGATTGCACTTTGGGTTAACGTATTAATGGGAATCATGGCATTTATCGCAATTTTATTCGCGATTCCTAATGATGATAAACGTGTCAAAGATGCGAAATAA
hypothetical protein4629.8621248951.30.951515Cellular processes; MetabolismCellular processes; Transport and binding proteinsToxin production and resistance; Otherdrug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) familyTIGR00711133.7putative transporterPF07690MFS_1Major Facilitator SuperfamilyCL0015MFS157.7Cytoplasmic MembraneMulti-transmembraneno predicted signal peptide14151220260A0A0H3K625YP_001331083
MNETYRGGNKLILGIVLGVITFWLFAQSLVNVVPNLQQSFGTDMGTISIAVSLTALFSGMFVVGAGGLADKIGRVKMTNIGLLLSIIGSALIIITNLPALLILGRVIQGVSAACIMPSTLAIMKTYYQGAERQRALSYWSIGSWGGSGICSLFGGAVATTMGWRWIFIFSIIVAVLSMLLIKGTPETKSEITNTHKFDVAGLIVLVVMLLSLNVVITKGAALGYTSLWFFGLIAIVIVAFFIFLNVEKKVDNPLIDFKLFENKPYTGATISNFLLNGVAGTLIVANTFVQQGLGYTALQAGYLSITYLIMVLLMIRVGEKLLQKMGSKRPMLLGTFIVVIGIALISLVFLPGIFYVISCVVGYLCFGLGLGIYATPSTDTAISNAPLDKVGVASGIYKMASSLGGAFGVAISGAVYAGAVAATSIHTGAMIALWVNVLMGIMAFIAILFAIPNDDKRVKDAK
no data available MicrobesOnline: NWMN_0047 > NWMN_0048NWMN_197015205410
locus tagold locus tagnew locus tagorganismpan locus tagpan gene symboltypesymbolsynonymproductcommentrepliconstrandstartendgene lengthessentialGene IDgene RefSeqMicrobesOnlineDNAdescriptionprotein lengththeoretical pItheoretical MWGRAVYECTIGRFAM Meta RoleTIGRFAM Main RoleTIGRFAM Sub RoleTIGRFAM functionTIGRFAMTIGRFAM HMM scoreTheSEEDPFAM AccessionPFAMPFAM descriptionPFAM clan accessionPFAM clanPFAM HMM scoreeffectorinteraction partnersPSORTbLocatePSignalPtransmembrane helicesprotein GIUniProtprotein RefSeqprotein sequenceprotein peptides detectedprotein copies per celloperonregulatorpubmed
NWMN_RS00005NWMN_0001S. aureus NewmanSAUPAN000006000dnaACDSNWMN_RS00005chromosomal replication initiator protein DnaAchromosome+51718781362unknownWP_001290433
ATGTCGGAAAAAGAAATTTGGGAAAAAGTGCTTGAAATTGCTCAAGAAAAATTATCAGCTGTAAGTTACTCAACTTTCCTAAAAGATACTGAGCTTTACACGATTAAAGATGGTGAAGCTATCGTATTATCGAGTATTCCTTTTAATGCAAATTGGTTAAATCAACAATATGCTGAAATTATCCAAGCAATCTTATTTGATGTTGTAGGCTATGAAGTTAAACCTCACTTTATTACTACTGAAGAATTAGCAAATTATAGTAATAATGAAACTGCTACTCCAAAAGAAACAACAAAACCTTCTACTGAAACAACTGAGGATAATCATGTGCTTGGTAGAGAGCAATTCAATGCCCATAACACATTTGACACTTTTGTAATCGGACCCGGTAACCGCTTTCCACATGCAGCGAGTTTAGCTGTGGCCGAAGCACCAGCCAAAGCGTACAATCCATTATTTATCTATGGAGGTGTTGGTTTAGGAAAAACCCATTTAATGCATGCCATTGGTCATCATGTTTTAGATAATAATCCAGATGCCAAAGTGATTTACACATCAAGTGAAAAATTCACAAATGAATTTATTAAATCAATTCGTGATAACGAAGGTGAAGCTTTCAGAGAAAGATATCGTAATATCGACGTCTTATTAATCGATGATATTCAGTTCATACAAAACAAGGTACAAACACAAGAAGAATTTTTCTATACTTTTAATGAATTGCATCAGAATAACAAGCAAATAGTTATTTCGAGTGATCGACCACCAAAGGAAATTGCACAATTAGAAGACCGATTACGTTCACGCTTTGAATGGGGGCTAATTGTTGATATTACGCCACCAGATTATGAAACTCGAATGGCAATTTTGCAGAAGAAAATTGAAGAAGAAAAATTAGATATTCCACCAGAAGCTTTAAATTATATAGCAAATCAAATTCAATCTAATATTCGTGAATTAGAAGGTGCATTAACACGTTTACTTGCATATTCACAATTATTAGGAAAACCAATTACAACTGAATTAACTGCTGAAGCTTTAAAAGATATCATTCAAGCACCAAAATCTAAAAAGATTACCATCCAAGATATTCAAAAAATTGTAGGCCAGTACTATAATGTTAGAATTGAAGATTTCAGTGCAAAAAAACGTACAAAGTCAATTGCATATCCGCGTCAAATAGCTATGTACTTGTCTAGAGAGCTTACAGATTTCTCATTACCTAAAATTGGTGAAGAATTTGGTGGGCGTGATCATACGACCGTCATTCATGCTCATGAAAAAATATCTAAAGATTTAAAAGAAGATCCTATTTTTAAACAAGAAGTAGAGAATCTTGAAAAAGAAATAAGAAATGTATAA
chromosomal replication initiator protein DnaA4535.1162651965.3-0.488742Genetic information processingDNA metabolismDNA replication, recombination, and repairchromosomal replication initiator protein DnaATIGR00362594.7PF00308Bac_DnaABacterial dnaA proteinCL0023P-loop_NTPase340.4Cytoplasmicno predicted signal peptide0447213177WP_001290433
MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSSIPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTETTEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQFIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITTELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV
no data available
NWMN_RS00010NWMN_0002S. aureus NewmanSAUPAN000007000dnaNCDSNWMN_RS00010DNA polymerase III subunit betachromosome+216332961134unknownWP_000969811
ATGATGGAATTCACTATTAAAAGAGATTATTTTATTACACAATTAAATGACACATTAAAAGCTATTTCACCAAGAACAACATTACCTATATTAACTGGTATCAAAATCGATGCGAAAGAACATGAAGTTATATTAACTGGTTCAGACTCTGAAATTTCAATAGAAATCACTATTCCTAAAACTGTAGATGGCGAAGATATTGTCAATATTTCAGAAACAGGCTCAGTAGTACTTCCTGGACGATTCTTTGTTGATATTATAAAAAAATTACCTGGTAAAGATGTTAAATTATCTACAAATGAACAATTCCAGACATTAATTACATCAGGTCATTCTGAATTTAATTTAAGTGGCTTAGATCCAGATCAATATCCTTTATTACCTCAAGTTTCTAGAGATGACGCAATTCAATTGTCGGTAAAAGTGCTTAAAAACGTGATTGCACAAACAAATTTTGCAGTGTCCACCTCAGAAACACGCCCAGTACTAACTGGTGTGAACTGGCTTATACAAGAAAATGAATTAATATGCACAGCGACTGACTCACACCGCTTGGCTGTAAGAAAGTTGCAGTTAGAAGATGTTTCTGAAAACAAAAATGTCATCATTCCAGGTAAGGCTTTAGCTGAATTAAATAAAATTATGTCTGACAATGAAGAAGACATTGATATCTTCTTTGCTTCAAACCAAGTTTTATTTAAAGTTGGAAATGTGAACTTTATTTCTCGATTATTAGAAGGACATTATCCTGATACAACACGTTTATTCCCTGAAAACTATGAAATTAAATTAAGTATAGACAATGGGGAGTTTTATCATGCGATTGATCGTGCCTCTTTATTAGCGCGTGAAGGTGGTAATAACGTTATTAAATTAAGTACAGGTGATGACGTTGTTGAATTGTCTTCTACATCACCAGAAATTGGTACTGTAAAAGAAGAAGTTGATGCAAACGATGTTGAAGGTGGTAGCCTGAAAATTTCATTCAACTCTAAATATATGATGGATGCTTTAAAAGCAATCGATAATGATGAGGTTGAAGTTGAATTCTTCGGTACAATGAAACCATTTATTCTAAAACCAAAAGGTGACGACTCGGTAACGCAATTAATTTTACCAATCAGAACTTACTAA
DNA polymerase III subunit beta3774.4028441913.3-0.1615382.7.7.7Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, beta subunitTIGR00663375.1PF00712DNA_pol3_betaDNA polymerase III beta subunit, N-terminal domainCL0060DNA_clamp184Cytoplasmicno predicted signal peptide0446892555WP_000969811
MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIRTY
no data available
NWMN_RS00015S. aureus NewmanCDSNWMN_RS00015RNA-binding proteinchromosome+36773922246unknownWP_001789359
GTGATTATTTTGGTTCAAGAAGTTGTAGTAGAAGGAGACATTAATTTAGGTCAATTTCTAAAAACAGAAGGGATTATTGAATCTGGTGGTCAAGCAAAATGGTTCTTGCAAGACGTTGAAGTATTAATTAATGGAGTGCGTGAAACACGTCGCGGTAAAAAGTTAGAACATCAAGATCGTATAGATATCCCAGAATTACCTGAAGATGCTGGTTCTTTCTTAATCATTCATCAAGGTGAACAATGA
RNA-binding protein814.355789137.35-0.197531Genetic information processingDNA metabolismDNA replication, recombination, and repairS4 domain protein YaaATIGR0298890PF13275S4_2S4 domainCL0492S474.4Cytoplasmicno predicted signal peptide0WP_001789359
MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ
no data available
NWMN_RS00020NWMN_0003S. aureus NewmanSAUPAN000010000recFCDSNWMN_RS00020DNA replication and repair protein RecFchromosome+391950311113unknownWP_000775113
ATGAAGTTAAATACACTCCAATTAGAAAATTATCGTAACTATGATGAGGTTACGTTGAAATGTCATCCTGACGTGAATATCCTCATTGGAGAAAATGCACAAGGAAAGACAAATTTACTTGAATCAATTTATACCTTAGCTTTAGCAAAAAGTCATAGAACGAGTAATGATAAGGAACTCATACGTTTTAATGCTGATTATGCTAAAATAGAAGGTGAGCTTAGTTATAGACACGGCACGATGCCATTAACAATGTTTATAACTAAAAAAGGTAAACAAGTCAAAGTGAATCACTTAGAGCAAAGTCGTCTAACTCAATATATTGGACACCTCAATGTGGTTCTATTTGCGCCAGAAGATTTGAATATTGTAAAAGGCTCTCCTCAAATAAGACGACGCTTTATAGATATGGAGTTGGGCCAAATTTCTGCTGTTTACTTAAATGATTTAGCTCAATACCAACGTATTTTAAAGCAAAAGAATAATTACTTAAAGCAGTTACAATTAGGCCAAAAAAAGGACTTAACAATGTTGGAAGTATTAAATCAGCAGTTTGCTGAATATGCAATGAAAGTAACTGATAAACGTGCACATTTTATTCAAGAGCTAGAGTCGTTAGCTAAACCGATTCATGCTGGTATCACAAATGATAAAGAAGCGTTGTCGCTGAATTATTTACCTAGTCTTAAATTTGATTATGCTCAAAATGAAGCGGCACGACTTGAAGAAATTATGTCTATTCTTAGCGATAATATGCAAAGAGAAAAAGAACGAGGCATTAGCTTATTCGGACCACATCGAGATGATATAAGTTTTGATGTGAATGGCATGGATGCTCAAACATATGGTTCTCAAGGACAGCAACGTACAACGGCTTTGTCCATTAAATTAGCTGAAATTGAGTTAATGAATATCGAAGTTGGGGAATATCCCATCTTATTATTAGACGATGTACTCAGTGAATTAGATGATTCGCGTCAAACGCATTTATTAAGTACGATTCAGCATAAAGTACAAACATTTGTCACTACGACATCTGTAGATGGTATTGATCATGAAATCATGAATAACGCTAAATTGTATCGTATTAATCAAGGTGAAATTATAAAGTAA
DNA replication and repair protein RecF3706.4468842415.1-0.444054Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA replication and repair protein RecFTIGR00611474.6PF02463SMC_NRecF/RecN/SMC N terminal domainCL0023P-loop_NTPase60.4
NWMN_RS00885; NWMN_RS00980; NWMN_RS02910; NWMN_RS02915; NWMN_RS02920; NWMN_RS02925; NWMN_RS02960; NWMN_RS02965; NWMN_RS04215; NWMN_RS04590; NWMN_RS05355; NWMN_RS05380; NWMN_RS05385; NWMN_RS05395; NWMN_RS06210; NWMN_RS06490; NWMN_RS06575; NWMN_RS06645; NWMN_RS07455; NWMN_RS07460; NWMN_RS07605; NWMN_RS08685; NWMN_RS08830; NWMN_RS08865; NWMN_RS08905; NWMN_RS08930; NWMN_RS08995; NWMN_RS09045; NWMN_RS09125; NWMN_RS10565; NWMN_RS11485; NWMN_RS12080; NWMN_RS12290; NWMN_RS12300; NWMN_RS12330; NWMN_RS12340; NWMN_RS12350; NWMN_RS12355; NWMN_RS12365; NWMN_RS12380; NWMN_RS12395; NWMN_RS12400; NWMN_RS12410; NWMN_RS12415; NWMN_RS12420; NWMN_RS12425; NWMN_RS14060; NWMN_RS14370
Cytoplasmicno predicted signal peptide0446697767WP_000775113
MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKELIRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQTYGSQGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQTFVTTTSVDGIDHEIMNNAKLYRINQGEIIK
no data available 21166474
NWMN_RS00025NWMN_0004S. aureus NewmanSAUPAN000011000gyrBCDSNWMN_RS00025DNA gyrase subunit Bchromosome+504169751935unknownWP_000255586
ATGGTGACTGCATTGTCAGATGTAAACAACACGGATAATTATGGTGCTGGGCAAATACAAGTATTAGAAGGTTTAGAAGCAGTACGTAAAAGACCAGGTATGTATATAGGATCGACTTCAGAGAGAGGTTTGCACCATTTAGTGTGGGAAATTGTCGATAATAGTATCGATGAAGCATTAGCTGGTTATGCAAATCAAATTGAAGTTGTTATTGAAAAAGATAACTGGATTAAAGTAACGGATAACGGACGTGGTATCCCAGTTGATATTCAAGAAAAAATGGGACGTCCAGCTGTCGAAGTTATTTTAACTGTTTTACATGCTGGTGGTAAATTTGGCGGTGGCGGATACAAAGTATCTGGTGGTTTACATGGTGTTGGTTCATCAGTTGTAAACGCATTGTCACAAGACTTAGAAGTATATGTACACAGAAATGAGACTATATATCATCAAGCATATAAAAAAGGTGTACCTCAATTTGACTTAAAAGAAGTTGGCACAACTGATAAGACAGGTACTGTCATTCGTTTTAAAGCAGATGGAGAAATCTTCACAGAGACAACTGTATACAACTATGAAACATTACAGCAGCGTATTAGAGAGCTTGCTTTCTTAAACAAAGGAATTCAAATCACATTAAGAGATGAACGTGATGAAGAAAACGTTAGAGAAGACTCCTATCACTATGAGGGCGGTATTAAATCGTACGTTGAGTTATTGAACGAAAATAAAGAACCTATTCATGATGAGCCAATTTATATTCATCAATCTAAAGATGATATTGAAGTAGAAATTGCGATTCAATATAACTCAGGATATGCCACAAATCTTTTAACTTACGCAAATAACATTCATACGTATGAAGGTGGTACGCATGAAGACGGATTCAAACGTGCATTAACGCGTGTCTTAAATAGTTATGGTTTAAGTAGCAAGATTATGAAAGAAGAAAAAGATAGACTTTCTGGTGAAGATACACGTGAAGGTATGACAGCAATTATATCTATCAAACATGGTGATCCTCAATTCGAAGGTCAAACGAAGACAAAATTAGGTAATTCTGAAGTGCGTCAAGTTGTAGATAAATTATTCTCAGAGCACTTTGAACGATTTTTATATGAAAATCCACAAGTCGCACGTACAGTGGTTGAAAAAGGTATTATGGCGGCACGTGCACGTGTTGCTGCGAAAAAAGCGCGTGAAGTAACACGTCGTAAATCAGCGTTAGATGTAGCAAGCCTTCCAGGTAAATTAGCCGATTGCTCTAGTAAAAGTCCTGAAGAATGTGAGATTTTCTTAGTCGAAGGGGACTCTGCCGGGGGGTCTACAAAATCTGGTCGTGACTCTAGAACGCAGGCGATTTTACCATTACGAGGTAAGATATTAAATGTTGAAAAAGCACGATTAGATAGAATTTTGAATAACAATGAAATTCGTCAAATGATCACAGCATTTGGTACAGGAATCGGTGGCGACTTTGATCTAGCGAAAGCAAGATATCACAAAATCGTCATTATGACTGATGCCGATGTGGATGGAGCGCATATTAGAACATTGTTATTAACATTCTTCTATCGATTTATGAGACCGTTAATTGAAGCAGGCTATGTGTATATTGCACAGCCACCGTTGTATAAACTGACACAAGGTAAACAAAAGTATTATGTATACAATGATAGGGAACTTGATAAACTTAAATCTGAATTGAATCCAACACCAAAATGGTCTATTGCACGATACAAAGGTCTTGGAGAAATGAATGCAGATCAATTATGGGAAACAACAATGAACCCTGAGCACCGCGCTCTTTTACAAGTAAAACTTGAAGATGCGATTGAAGCGGACCAAACATTTGAAATGTTAATGGGTGACGTTGTAGAAAACCGTAGACAATTTATAGAAGATAATGCAGTTTATGCAAACTTAGACTTCTAA
DNA gyrase subunit B6445.6814572539.3-0.4899075.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, B subunitTIGR01059994PF00204DNA_gyraseBDNA gyrase BCL0329S5211.1
NWMN_RS00030; NWMN_RS02960; NWMN_RS06645; NWMN_RS08930
Cytoplasmicno predicted signal peptide0446177731WP_000255586
MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
no data available 21166474
NWMN_RS00030NWMN_0005S. aureus NewmanSAUPAN000012000gyrACDSNWMN_RS00030DNA gyrase subunit Achromosome+701296752664unknownWP_000819088
ATGGCTGAATTACCTCAATCAAGAATAAATGAACGAAATATTACCAGTGAAATGCGTGAATCATTTTTAGATTATGCGATGAGTGTTATCGTTGCTCGTGCATTGCCAGATGTTCGTGACGGTTTAAAACCAGTACATCGTCGTATACTATATGGATTAAATGAACAAGGTATGACACCGGATAAATCATATAAAAAATCAGCACGTATCGTTGGTGACGTAATGGGTAAATATCACCCTCATGGTGACTCATCTATTTATGAAGCAATGGTACGTATGGCTCAAGATTTCAGTTATCGTTATCCGCTTGTTGATGGCCAAGGTAACTTTGGTTCAATGGATGGAGATGGCGCAGCAGCAATGCGTTATACTGAAGCGCGTATGACTAAAATCACACTTGAACTGTTACGTGATATTAATAAAGATACAATAGATTTTATCGATAACTATGATGGTAATGAAAGAGAGCCGTCAGTCTTACCTGCTCGATTCCCTAACTTATTAGCCAATGGTGCATCAGGTATCGCGGTAGGTATGGCAACGAATATTCCACCACATAACTTAACAGAATTAATCAATGGTGTACTTAGCTTAAGTAAGAACCCTGATATTTCAATTGCTGAGTTAATGGAGGATATTGAAGGTCCTGATTTCCCAACTGCTGGACTTATTTTAGGTAAGAGTGGTATTAGACGTGCATATGAAACAGGTCGTGGTTCAATTCAAATGCGTTCTCGTGCAGTTATTGAAGAACGTGGAGGCGGACGTCAACGTATTGTTGTCACTGAAATTCCTTTCCAAGTGAATAAGGCTCGTATGATTGAAAAAATTGCAGAGCTCGTTCGTGACAAGAAAATTGACGGTATCACTGATTTACGTGATGAAACAAGTTTACGTACTGGTGTGCGTGTCGTTATTGATGTGCGTAAGGATGCAAATGCTAGTGTCATTTTAAATAACTTATACAAACAAACACCTCTTCAAACATCATTTGGTGTGAATATGATTGCACTTGTAAATGGTAGACCGAAGCTTATTAATTTAAAAGAAGCGTTGGTACATTATTTAGAGCATCAAAAGACAGTTGTTAGAAGACGTACGCAATACAACTTACGTAAAGCTAAAGATCGTGCCCACATTTTAGAAGGATTACGTATCGCACTTGACCATATCGATGAAATTATTTCAACGATTCGTGAGTCAGATACAGATAAAGTTGCAATGGAAAGCTTGCAACAACGCTTCAAACTTTCTGAAAAACAAGCTCAAGCTATTTTAGACATGCGTTTAAGACGTCTAACAGGTTTAGAGAGAGACAAAATTGAAGCTGAATATAATGAGTTATTAAATTATATTAGTGAATTAGAAGCAATCTTAGCTGATGAAGAAGTGTTATTACAGTTAGTTAGAGATGAATTGACTGAAATTAGAGATCGTTTCGGTGATGATCGTCGTACAGAAATTCAATTAGGTGGATTTGAAAACTTAGAGGACGAAGACTTAATTCCAGAAGAACAAATAGTAATTACACTAAGCCATAATAACTACATTAAACGTTTGCCGGTATCTACATATCGTGCTCAAAACCGTGGTGGTCGTGGTGTTCAAGGTATGAATACATTGGAAGAAGATTTTGTCAGTCAATTGGTAACTTTAAGTACACATGACCATGTATTGTTCTTTACTAACAAAGGTCGTGTATACAAACTTAAAGGTTACGAAGTGCCTGAGTTATCAAGACAGTCTAAAGGTATTCCTGTAGTGAATGCTATTGAACTTGAAAATGATGAAGTCATTAGTACAATGATTGCTGTTAAAGACCTTGAAAGTGAAGACAACTTCTTAGTGTTTGCAACTAAACGTGGTGTCGTTAAACGTTCAGCATTAAGTAACTTCTCAAGAATAAATAGAAATGGTAAGATTGCGATTTCGTTCAGAGAAGATGATGAGTTAATTGCAGTTCGCTTAACAAGTGGTCAAGAAGATATCTTGATTGGTACATCACATGCATCATTAATTCGATTCCCTGAATCAACATTACGTCCTTTAGGCCGTACAGCAACGGGTGTGAAAGGTATTACACTTCGTGAAGGTGACGAAGTTGTAGGGCTTGATGTAGCTCATGCAAACAGTGTTGATGAAGTATTAGTAGTTACTGAAAATGGTTATGGTAAACGTACGCCAGTTAATGACTATCGCTTATCAAATCGTGGTGGTAAAGGTATTAAAACAGCTACGATTACTGAGCGTAATGGTAATGTTGTATGTATCACTACAGTAACTGGTGAAGAAGATTTAATGATTGTTACTAATGCAGGTGTCATTATTCGACTAGATGTTGCAGATATTTCTCAAAATGGTCGTGCAGCACAAGGTGTTCGCTTAATTCGCTTAGGTGATGATCAATTTGTTTCAACGGTTGCTAAAGTAAAAGAAGATGCAGAAGATGAAACGAATGAAGATGAGCAATCTACTTCAACTGTATCTGAAGATGGTACTGAACAACAACGTGAAGCGGTTGTAAATGATGAAACACCAGGAAATGCAATTCATACTGAAGTGATTGATTCAGAAGAAAATGATGAAGATGGACGTATTGAAGTAAGACAAGATTTCATGGATCGTGTTGAAGAAGATATACAACAATCATCAGATGAAGAATAA
DNA gyrase subunit A8874.7979899349.3-0.4491545.99.1.3Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, A subunitTIGR010631210.8PF00521DNA_topoisoIVDNA gyrase/topoisomerase IV, subunit Ano clan definedno clan defined529.8
NWMN_RS07455
Cytoplasmicno predicted signal peptide0446741832WP_000819088
MAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELEAILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLGGFENLEDEDLIPEEQIVITLSHNNYIKRLPVSTYRAQNRGGRGVQGMNTLEEDFVSQLVTLSTHDHVLFFTNKGRVYKLKGYEVPELSRQSKGIPVVNAIELENDEVISTMIAVKDLESEDNFLVFATKRGVVKRSALSNFSRINRNGKIAISFREDDELIAVRLTSGQEDILIGTSHASLIRFPESTLRPLGRTATGVKGITLREGDEVVGLDVAHANSVDEVLVVTENGYGKRTPVNDYRLSNRGGKGIKTATITERNGNVVCITTVTGEEDLMIVTNAGVIIRLDVADISQNGRAAQGVRLIRLGDDQFVSTVAKVKEDAEDETNEDEQSTSTVSEDGTEQQREAVVNDETPGNAIHTEVIDSEENDEDGRIEVRQDFMDRVEEDIQQSSDEE
no data available 21166474
NWMN_RS00035NWMN_0006S. aureus NewmanSAUPAN000013000nnrDCDSNWMN_RS00035NAD(P)H-hydrate dehydratasechromosome-976210574813unknownWP_000449218
ATGGAAACGTTAAATTCTATTAACATTCCTAAGCGTAAAGAAGATTCACATAAAGGTGATTATGGCAAAATTTTATTAATTGGTGGATCTGCTAACTTAGGTGGTGCCATTATGTTAGCGGCTCGTGCATGTGTATTTAGCGGTAGTGGTTTAATCACTGTAGCTACACATCCAACAAATCATTCAGCATTACATTCTCGTTGCCCAGAAGCGATGGTTATTGATATTAATGATACGAAAATGTTGACGAAAATGATTGAAATGACTGACAGTATACTAATTGGTCCAGGTCTTGGCGTTGATTTCAAAGGAAATAATGCCATTACATTCCTACTACAAAATATACAACCGCATCAAAATTTAATCGTAGACGGCGATGCGATTACAATCTTTAGTAAACTGAAACCGCAATTACCTACATGTCGTGTGATCTTTACACCACACCTCAAAGAATGGGAACGATTAAGTGGTATTCCTATTGAGGAACAGACATATGAGCGTAATCGTGAAGCAGTTGATCGTTTAGGTGCAACTGTTGTACTTAAAAAACATGGTACTGAAATTTTCTTTAAAGATGAAGACTTTAAATTGACAATCGGTAGCCCAGCAATGGCGACTGGTGGTATGGGCGATACACTTGCTGGTATGATTACAAGCTTTGTCGGTCAATTTGATAACTTAAAAGAAGCGGTTATGAGTGCCACATATACACATAGTTTTATTGGCGAAAACCTTGCAAAAGATATGTATGTGGTGCCACCATCAAGACTTATCAATGAAATACCTTACGCAATGAAACAATTAGAAAGTTAG
NAD(P)H-hydrate dehydratase2706.512229549-0.05259264.2.1.136Unknown functionGeneralYjeF family C-terminal domainTIGR00196185.2PF01256Carb_kinaseCarbohydrate kinaseCL0118Ribokinase194.5no significant predictionno predicted signal peptide1446371363WP_000449218
METLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIMLAARACVFSGSGLITVATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGLGVDFKGNNAITFLLQNIQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSGIPIEEQTYERNREAVDRLGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGMITSFVGQFDNLKEAVMSATYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES
no data available
NWMN_RS00040NWMN_0007S. aureus NewmanSAUPAN000014000hutHCDSNWMN_RS00040histidine ammonia-lyasechromosome+10900124141515unknownWP_000177464
ATGACTTTATATTTAGATGGTGAAACACTAACAATTGAGGATATTAAATCATTTTTACAACAACAATCAAAGATTGAAATTATTGATGATGCGTTAGAACGTGTCAAAAAAAGTAGAGCGGTAGTTGAACGTATTATTGAAAATGAGGAAACGGTTTACGGTATTACTACAGGTTTTGGGTTATTTAGTGATGTACGTATAGACCCGACGCAATATAATGAATTACAAGTGAATCTGATACGCTCACATGCCTGTGGACTAGGTGAGCCATTTTCAAAAGAAGTAGCATTAGTCATGATGATTTTACGATTGAATACATTATTAAAAGGTCATTCAGGTGCCACTTTAGAATTAGTGAGACAATTACAATTTTTTATAAATGAACGTATTATACCGATAATCCCACAGCAAGGCTCTCTCGGTGCATCAGGAGATTTAGCGCCATTATCACATTTAGCATTAGCATTAATTGGTGAAGGGAAAGTATTGTACAGAGGGGAAGAAAAGGATAGTGACGATGTATTAAGAGAATTAAATAGACAACCTTTGAACCTTCAGGCTAAAGAAGGTTTAGCATTGATTAATGGTACGCAAGCTATGACAGCTCAAGGTGTCATTAGTTATATAGAAGCAGAAGATTTAGGTTACCAATCTGAATGGATTGCTGCATTAACGCATCAGTCTCTTAATGGCATTATAGATGCATATCGACATGATGTGCACGCAGTTCGTAATTTTCAAGAACAGATTAATGTGGCAGCGCGTATGCGTGATTGGTTAGAAGGATCAACATTAACGACGCGACAATCAGAAATACGTGTACAAGATGCATATACGTTGCGTTGTATACCACAAATCCATGGCGCGAGTTTTCAAGTATTCAATTATGTTAAACAGCAATTAGAATTTGAAATGAATGCGGCTAATGATAATCCACTTATATTTGAGGAAGCAAATGAAACGTTTGTTATTTCAGGTGGTAACTTCCATGGACAACCTATTGCTTTTGCATTAGATCATCTTAAATTAGGTGTAAGTGAATTAGCAAACGTATCGGAACGTCGTCTAGAGCGACTAGTAAATCCTCAATTAAATGGTGATTTACCAGCATTTCTTAGTCCAGAGCCAGGATTGCAAAGTGGCGCGATGATTATGCAATATGCTGCTGCAAGTCTCGTTTCTGAAAATAAAACTTTAGCGCATCCAGCGAGTGTTGATTCTATCACTTCATCTGCGAACCAAGAAGATCACGTATCTATGGGAACTACAGCTGCTAGACATGGTTATCAAATTATTGAAAATGCAAGACGTGTGCTGGCAATCGAATGTGTTATTGCATTACAAGCAGCAGAGTTAAAAGGTGTTGAAGGATTATCACCAAAAACACGTCGCAAGTATGATGAGTTTCGAAGTATCGTGCCATCCATTACACATGATCGTCAATTTCATAAAGATATTGAAGCGGTTGCACAGTATTTAAAGCAATCAATTTATCAAACGACTGCATGTCACTAA
histidine ammonia-lyase5045.1467156075.2-0.1857144.3.1.3MetabolismEnergy metabolismAmino acids and amineshistidine ammonia-lyaseTIGR01225665PF00221Lyase_aromaticAromatic amino acid lyaseno clan definedno clan defined612.4Cytoplasmicno predicted signal peptide0446099609WP_000177464
MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERIIENEETVYGITTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRLNTLLKGHSGATLELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVLYRGEEKDSDDVLRELNRQPLNLQAKEGLALINGTQAMTAQGVISYIEAEDLGYQSEWIAALTHQSLNGIIDAYRHDVHAVRNFQEQINVAARMRDWLEGSTLTTRQSEIRVQDAYTLRCIPQIHGASFQVFNYVKQQLEFEMNAANDNPLIFEEANETFVISGGNFHGQPIAFALDHLKLGVSELANVSERRLERLVNPQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTLAHPASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKGVEGLSPKTRRKYDEFRSIVPSITHDRQFHKDIEAVAQYLKQSIYQTTACH
no data available
NWMN_RS15015S. aureus NewmanCDSNWMN_RS15015hypothetical proteinchromosome-1261512803189unknownWP_001803754
ATGTCTAACATTAACCTTCATCCTTTCCCAAATAATTATCATTTATTATGGAATGACGTACGTCTTTATTTTTTAGAAAATAAAAAAAGACCACATCCCTACAAGGGACGTGGTCTACGCGTTGCCACCCTATTTAACAATTTAAGTTATAAAGATACACTAAACCTAAATTGCACTTCACTAAAATAA
hypothetical protein6210.37987404.49-0.662903no significant predictionno predicted signal peptide0WP_001803754
MSNINLHPFPNNYHLLWNDVRLYFLENKKRPHPYKGRGLRVATLFNNLSYKDTLNLNCTSLK
no data available
NWMN_RS00045NWMN_0008S. aureus NewmanSAUPAN000017000serSCDSNWMN_RS00045serine--tRNA ligasechromosome+12793140791287unknownWP_000884334
ATGTTAGACATTAGATTATTCAGAAATGAGCCTGACACAGTTAAGAGCAAAATTGAATTACGTGGAGATGATCCAAAAGTTGTAGATGAAATTTTAGAATTGGATGAGCAACGACGTAAATTAATTAGTGCAACAGAAGAAATGAAAGCACGTCGTAATAAAGTAAGCGAAGAAATCGCATTAAAAAAACGTAATAAAGAAAATGCTGATGATGTGATTGCTGAAATGCGCACATTAGGTGACGATATTAAAGAAAAAGATAGTCAATTAAATGAAATTGATAATAAAATGACAGGTATCCTTTGTCGTATTCCAAATTTAATAAGTGATGATGTACCTCAAGGTGAATCTGATGAAGATAACGTTGAAGTTAAAAAGTGGGGTACACCACGTGAGTTTTCATTTGAACCCAAAGCACATTGGGATATTGTAGAAGAATTGAAAATGGCTGATTTTGATCGTGCAGCAAAAGTTTCAGGTGCGCGTTTTGTATATTTAACAAATGAAGGTGCGCAATTAGAGCGTGCTTTAATGAACTATATGATTACAAAACATACAACACAACATGGTTATACAGAAATGATGGTACCACAGCTTGTGAACGCAGATACAATGTATGGTACAGGTCAATTACCTAAATTTGAAGAAGATTTATTTAAAGTAGAAAAAGAAGGATTATATACAATTCCAACTGCTGAAGTACCATTAACGAATTTCTACCGTAATGAAATTATTCAACCAGGTGTACTTCCTGAAAAATTCACTGGTCAATCTGCATGTTTCCGTAGTGAAGCAGGATCAGCAGGTAGAGATACAAGAGGATTAATTCGTTTACATCAATTCGATAAAGTGGAAATGGTACGTTTTGAACAACCTGAAGATTCATGGAATGCTTTAGAAGAAATGACAACAAACGCAGAAGCAATTCTAGAAGAGTTAGGTTTACCATACCGTCGTGTTATTTTATGTACAGGTGATATTGGATTTAGTGCAAGCAAAACATATGATTTAGAAGTTTGGTTACCAAGCTACAATGATTATAAAGAAATTAGTTCATGCTCAAACTGTACGGATTTCCAAGCGCGTCGTGCTAACATCCGCTTCAAGCGTGACAAAGCAGCTAAACCAGAATTAGCACATACATTAAATGGTAGTGGTTTAGCAGTTGGACGTACATTTGCTGCTATTGTTGAAAATTACCAAAATGAAGATGGAACAGTAACAATTCCAGAAGCATTAGTACCATTTATGGGTGGTAAAACACAAATTTCAAAACCAGTTAAATAA
serine--tRNA ligase4284.7466548639.7-0.5866826.1.1.11Genetic information processingProtein synthesistRNA aminoacylationserine--tRNA ligaseTIGR00414571.6PF00587tRNA-synt_2btRNA synthetase class II core domain (G, H, P, S and T)CL0040tRNA_synt_II114.8
NWMN_RS02960; NWMN_RS02965; NWMN_RS04195; NWMN_RS05380; NWMN_RS05385; NWMN_RS05390; NWMN_RS05395; NWMN_RS06575; NWMN_RS07460; NWMN_RS08350; NWMN_RS08795; NWMN_RS08930; NWMN_RS08970; NWMN_RS12080; NWMN_RS12410; NWMN_RS14560
Cytoplasmicno predicted signal peptide0446807078WP_000884334
MLDIRLFRNEPDTVKSKIELRGDDPKVVDEILELDEQRRKLISATEEMKARRNKVSEEIALKKRNKENADDVIAEMRTLGDDIKEKDSQLNEIDNKMTGILCRIPNLISDDVPQGESDEDNVEVKKWGTPREFSFEPKAHWDIVEELKMADFDRAAKVSGARFVYLTNEGAQLERALMNYMITKHTTQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVEKEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRDTRGLIRLHQFDKVEMVRFEQPEDSWNALEEMTTNAEAILEELGLPYRRVILCTGDIGFSASKTYDLEVWLPSYNDYKEISSCSNCTDFQARRANIRFKRDKAAKPELAHTLNGSGLAVGRTFAAIVENYQNEDGTVTIPEALVPFMGGKTQISKPVK
no data available 21166474
NWMN_RS00050NWMN_0009S. aureus NewmanSAUPAN000018000-CDSNWMN_RS00050branched-chain amino acid ABC transporter permeasechromosome+1472915424696unknownWP_000207095
ATGACAACACATTTAAGTTTTAGACAAGGCGTGCAAGAGTGTATCCTAACATTATTGGGTTATGCCGGTGTTGGTATTTCATTTGGTATTGTGGCTTCGTCTCAAAACTTTAGTATTTTAGAAATTGTCTTGTTATGTCTTGTTATATATGCCGGTGCTGCGCAATTTATTATGTGCGCGTTGTTTATAGCAGGTACACCTATATCAGCGATTGTACTAACTGTATTTATCGTAAATTCAAGAATGTTCCTTTTAAGTATGTCGCTTGCACCAAACTTCAAGACATATGGGTTTTGGAACCGTGTTGGATTAGGTTCATTAGTAACTGACGAAACGTTTGGCGTCGCCATTACACCTTATTTAAAAGGAGAAGCTATCAATGATCGTTGGATGCATGGTCTTAACATCACAGCATATTTATTTTGGGCAATTTCATGTGTAGCTGGGGCTTTATTTGGCGAATATATCTCAAATCCGCAAACGCTAGGGTTAGATTTTGCTATCACGGCTATGTTTATCTTTTTGGCCATTGCGCAATTTGAATCAATTACTAAATCGCGATTAAGAATTTACATAGTACTCATTATTGCCGTCATAGTAATGATGTTATCGCTAAGTATGTTTATGCCTTCATATCTAGCAATATTAATTGCAGCCACAATTTCAGCAGCGTTAGGAGTGATGATGGAACAATGA
branched-chain amino acid ABC transporter permease2316.49023251631.07186MetabolismTransport and binding proteinsAmino acids, peptides and aminesazaleucine resistance protein AzlCTIGR0034685.5PF03591AzlCAzlC proteinno clan definedno clan defined126.3Cytoplasmic Membraneno predicted signal peptide7446129240WP_000207095
MTTHLSFRQGVQECILTLLGYAGVGISFGIVASSQNFSILEIVLLCLVIYAGAAQFIMCALFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGLGSLVTDETFGVAITPYLKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQTLGLDFAITAMFIFLAIAQFESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATISAALGVMMEQ
no data available
NWMN_RS00055NWMN_0010S. aureus NewmanSAUPAN000019000-CDSNWMN_RS00055membrane proteinchromosome+1542115750330unknownWP_000628050
ATGATAACTCATATGAACATGTTAATACTTATTTTATTGTGTGGTATCGTAACGCTATTAATTCGAATTATACCTTTTATCATGATTTCAAAAGTGCAATTGCCTGATGTCGTGGTTCGATGGCTATCATTTATCCCAATCACACTATTTACAGCACTTGTCATTGACAGCATTATTCAACAGACGCCTCATGGTGAGGGGTATACATTAAACATCCCTTACATTATCGCGCTCATTCCGACGGTTATTTTATCTATAATCACGCGTAGTTTAACTATTACAATTATTAGTGGGATTGTTATCATGGCAGCATTACGATTTTTCTTTTAA
membrane protein1099.2996112233.11.47523Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein FTIGR021209.3PF05437AzlDBranched-chain amino acid transport protein (AzlD)no clan definedno clan defined83.4Cytoplasmic Membraneno predicted signal peptide4446550704WP_000628050
MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFIPITLFTALVIDSIIQQTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAALRFFF
no data available
NWMN_RS00060NWMN_0011S. aureus NewmanSAUPAN000021000metXCDSNWMN_RS00060homoserine O-acetyltransferasechromosome+1611317081969unknownWP_000186481
ATGACAAATTACACAGTAGATACTTTAAATTTAGGGGAATTTATTACAGAATCTGGGGAAGTCATAGATAACTTGCGTTTGAGATATGAGCATGTCGGTTATCATGGACAACCATTAGTTGTAGTTTGTCATGCATTAACTGGCAATCATTTAACATATGGAACAGATGATTATCCGGGTTGGTGGCGAGAAATTATTGATGGGGGATATATACCCATTCACGATTATCAATTTTTAACATTTGATGTTATTGGTAGTCCTTTCGGTTCAAGTTCACCTTTAAACGACCCTCATTTTCCTAAAAAATTAACATTAAGAGATATAGTCAGAGCGAATGAACGAGGTATACAAGCCCTTGGTTATGATAAGATTAATATTTTAATAGGGGGAAGTCTTGGAGGTATGCAAGCAATGGAACTACTCTACAATCAACAGTTTGAAGTAGATAAAGCCATTATCCTTGCTGCAACAAGTCGAACATCATCTTATAGTAGAGCTTTCAATGAAATTGCAAGGCAAGCCATTCATCTTGGTGGTAAGGAAGGTCTAAGTATTGCACGCCAATTAGGTTTTTTGACATATCGATCATCAAAAAGTTATGATGAACGTTTCACGCCGGATGAAGTAGTCGCATACCAACAACATCAAGGTAATAAATTTAAAGAACATTTTGATTTGAATTGTTATCTGACACTGCTAGATGTATTGGATAGTCACAACATTGACCGAGGTCGCACAGACGTAACGCATGTTTTTAAAAATTTAGAAACAAAAGTGTTAACGATGGGGTTCATAGATGATTTGCTATATCCGGATGATCAAGTTCGTGCATTAGGTGAACGTTTTAAATATCATCGTCATTTCTTCGTGCCTGATAATGTTGGGCATGATGGATTCCTACTAAACTTTAGTACCTGGGCACCTAACTTATATCATTTCTTAAATTTAAAGCATTTTAAGCGTAAGTAA
homoserine O-acetyltransferase3226.614736927.4-0.349068MetabolismAmino acid biosynthesisAspartate familyhomoserine O-acetyltransferaseTIGR01392202PF00561Abhydrolase_1alpha/beta hydrolase foldCL0028AB_hydrolase59.4Cytoplasmicno predicted signal peptide0446108626WP_000186481
MTNYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRK
no data available
NWMN_RS00065NWMN_0012S. aureus NewmanSAUPAN000023000-CDSNWMN_RS00065membrane proteinchromosome+1737218310939unknownWP_001791710
ATGGGAGTGGCTTATGTGTTTTCAAAAATACAACCTAAAGCAACAATAATTGCAACGATTGCGTTGGTATTTGTCGCTTTAGCTTTATATCTAGTGCCTGGTTTAGGACTAATATTTGCATTATTTGCAACCATACCAGGTATCGTTTTATGGAATAAATCAATACAATCTTTCGGGATTAGTGCACTTATTACAGTAATTATAACAACTGTTTTAGGTAATACTTTCGTTTTAAGTGCCATCATATTAGTCTTAATTGCAAGTTTAATTATTGGTCAATTGCTCAAAGAAAGAACGTCTAAAGAAAGAATATTATACGTAACAACAGTAGCGATGAGCTTAATTTCATTAATCGCTTTTATGTTACTACAAACATTCGGAAGGATTCCACCATCAGCGAGCATAGTAAAACCTTTCAAGCAAACATTACATGAAGCGATTACGATGAGCGGTGCCGATGCGAATATGACCCAAATATTAGAAGAAGGGTTTAGACAAGCGACCGTTCAATTACCAGGTTTCATCATTATCATTACATTTTTAATCGTCTTAATTAACTTAATCGTTACATTTCCGATTTTACGAAAATTTAAAATCGCTACACCTGTATTTAAGCCACTTTTCGCGTGGCAAATGAGCGGTATTTTATTATGGATATACATTATTGTTATCATATGTTTATTATTTACAGGTCAACCGAGTGTGTTCCAGAGCATTCTTTTAAACTTCCAACTTGTGTTATCATTAGTAATGTATATTCAAGGTTTAAGTGTTATTCATTTCTTTGGTAAAGCGAAAGGTTTGCCGAATGCAGTAACGATTTTACTATTGGTTATCGGTACAATACTGACACCTACGACACATATTGTAGGACTACTTGGTGTTATCGATTTAAGTTTGAATTTGAAGCGAATCATGAAAAATAATTCTAAAAAGTGA
membrane protein31210.865834148.51.14551PF09991DUF2232Predicted membrane protein (DUF2232)no clan definedno clan defined212.7Cytoplasmic Membraneno predicted signal peptide7487707478WP_001791710
MGVAYVFSKIQPKATIIATIALVFVALALYLVPGLGLIFALFATIPGIVLWNKSIQSFGISALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSKERILYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILEEGFRQATVQLPGFIIIITFLIVLINLIVTFPILRKFKIATPVFKPLFAWQMSGILLWIYIIVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLVIGTILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
no data available
NWMN_RS00070NWMN_0013S. aureus NewmanSAUPAN000024000-CDSNWMN_RS00070DHH family phosphoesterasechromosome+18325202921968unknownWP_001081634
ATGAATCGGCAGTCCACTAAGAAAGCTTTACTAATACCATTTGTCATCATGATCATCACAGCAATTGTTTTAATGGGTGTATGGTTTATCTTTAATAGTCTTATAGCACTAATTGCATCTATCGTTCTTGTCGTGATGATTATTGTTAGCATCATTTTATTCAGACAAGCTTTAATGAAAATGGATAGTTATGTAGATGGTTTGAGTGCTCAAATTTCAACAACAAATAATAAAGCAATCAAACATTTACCAATTGGTATCATTGTTTTAGATGAAAATGATCACATCGAATGGGTTAACCAATTTATGACAGATCATATGGAAGCGAATGTCATTTCTGAATCTGTAAATGAAGTATTTCCAAACATTTTAAAGCAATTAGATAGAGTGAAATCCGTTGAAATAGAATATAATCAGTATCATTTCCAAGTACGTTATTCTGAGAATGATCACTGCCTCTATTTCTTTGATATAACTGAACAAGTACAAACAAATGAACTATATGAAAATTCTAAACCAATCATTGCGACATTATTTTTAGATAACTACGATGAGATTACGCAAAATATGAATGATACGCAGCGTTCGGAAATCAACTCAATGGTAACGCGTGTCATTAGTCGATGGGCAACTGAGTATAATATATTTTTCAAAAGATACAGTTCCGATCAATTCGTAGCCTATTTAAATCAAAAAATATTAGCTGACTTAGAAGAATCTAAATTTGATATCTTGAGTCAATTACGTGAAAAAAGTGTTGGTTATCGTGCCCAATTAACATTAAGTATCGGTGTTGGTGAAGGTACTGAAAATTTAATCGACTTAGGTGAATTATCACAATCAGGCCTAGACTTAGCATTAGGACGCGGTGGCGACCAAGTTGCAATTAAAAGTATTAATGGTAATGTGCGTTTCTATGGCGGTAAGACTGACCCGATGGAGAAACGTACTCGTGTAAGAGCACGTGTGATCTCACATGCGTTAAAAGATATCCTTGCAGAGGGTGACAAAGTCATTATCATGGGACATAAACGTCCTGACTTAGATGCAATTGGTGCAGCAATCGGTGTGTCTAGATTTGCAATGATGAATAATTTAGAAGCATACATCGTATTAAATGAGACTGACATTGATCCAACATTACGACGCGTGATGAACGAAATAGATAAAAAGCCAGAGTTAAGAGAGCGATTTATTACATCAGATGATGCTTGGGATATGATGACATCTAAGACAACCGTAGTGATTGTTGATACGCATAAACCGGAACTGGTTTTAGATGAAAATGTCTTAAATAAAGCAAACCGTAAAGTTGTTATCGATCATCATAGACGTGGTGAAAGCTTCATCTCTAATCCATTGTTGATATATATGGAACCATACGCAAGTTCGACAGCTGAATTGGTAACAGAGTTACTGGAATATCAACCAACAGAACAACGTTTAACACGTCTTGAATCAACAGTGATGTATGCAGGTATTATTGTAGATACAAGAAACTTTACATTACGAACAGGATCAAGAACATTCGATGCAGCGAGTTATTTACGTGCACATGGTGCAGATACGATTTTAACGCAACATTTCTTAAAAGATGATGTGGATACTTACATTAATCGATCTGAATTAATTCGAACTGTAAAAGTTGAAGATAATGGCATAGCCATTGCGCATGGTTCAGACGATAAAATTTATCATCCAGTAACAGTTGCACAAGCAGCAGATGAACTGTTAAGTTTAGAAGGTATTGAAGCATCATATGTTGTTGCGAGACGTGAAGATAATCTGATTGGTATATCTGCGCGTTCACTCGGTTCAGTAAATGTCCAGTTAACAATGGAAGCACTTGGTGGCGGTGGACATTTAACCAATGCGGCAACACAACTTAAAGGTGTGACAGTCGAAGAGGCGATAGCACAATTACAACAAGCAATTACAGAACAATTAAGTAGGAGTGAAGATGCATGA
DHH family phosphoesterase6554.9008373780.7-0.110229Signal transductionSignal transductionTwo-component systemsphosphate regulon sensor kinase PhoRTIGR0296617.5PF01368DHHDHH familyCL0137HAD79.2Cytoplasmicno predicted signal peptide2447004378WP_001081634
MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVVMIIVSIILFRQALMKMDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMTDHMEANVISESVNEVFPNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQTNELYENSKPIIATLFLDNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSSDQFVAYLNQKILADLEESKFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQSGLDLALGRGGDQVAIKSINGNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVIIMGHKRPDLDAIGAAIGVSRFAMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFITSDDAWDMMTSKTTVVIVDTHKPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYMEPYASSTAELVTELLEYQPTEQRLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLRAHGADTILTQHFLKDDVDTYINRSELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADELLSLEGIEASYVVARREDNLIGISARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVEEAIAQLQQAITEQLSRSEDA
no data available
NWMN_RS00075NWMN_0014S. aureus NewmanSAUPAN000025000rplICDSNWMN_RS0007550S ribosomal protein L9chromosome+2028920735447unknownWP_000864305
ATGAAAGTAATTTTTACACAAGATGTTAAAGGTAAAGGTAAAAAAGGTGAAGTTAAAGAAGTACCAGTAGGTTATGCAAATAACTTCTTATTGAAAAAGAATTATGCTGTAGAAGCAACACCAGGTAACCTTAAACAATTAGAGTTACAGAAAAAACGTGCAAAACAAGAACGCCAACAAGAAATTGAAGATGCTAAAGCATTAAAAGAAACGTTATCAAACATTGAAGTTGAAGTATCAGCAAAAACTGGTGAAGGTGGTAAATTGTTTGGGTCAGTAAGTACAAAACAAATTGCCGAAGCACTAAAAGCACAACATGATATTAAAATTGATAAACGTAAAATGGATTTACCAAATGGAATTCATTCCCTAGGATATACGAATGTACCTGTTAAATTAGATAAAGAAGTTGAAGGTACAATTCGCGTACACACAGTTGAACAATAA
50S ribosomal protein L914810.065416453.8-0.681757Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL9TIGR00158149.7PF03948Ribosomal_L9_CRibosomal protein L9, C-terminal domainno clan definedno clan defined98.6
NWMN_RS02420; NWMN_RS02910; NWMN_RS02920; NWMN_RS03640; NWMN_RS08930; NWMN_RS12420
Cytoplasmicno predicted signal peptide0446787049WP_000864305
MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
no data available 21166474
NWMN_RS00080NWMN_0015S. aureus NewmanSAUPAN000026000dnaCCDSNWMN_RS00080replicative DNA helicasechromosome+20767221671401unknownWP_000375647
ATGGATAGAATGTATGAGCAAAATCAAATGCCGCATAACAATGAAGCTGAACAGTCTGTCTTAGGTTCAATTATTATAGATCCAGAATTGATTAATACTACTCAGGAAGTTTTGCTTCCTGAGTCGTTTTATAGGGGTGCCCATCAACATATTTTCCGTGCAATGATGCACTTAAATGAAGATAATAAAGAAATTGATGTTGTAACATTGATGGATCAATTATCGACGGAAGGTACGTTGAATGAAGCGGGTGGCCCGCAATATCTTGCAGAGTTATCTACAAATGTACCAACGACGCGAAATGTTCAGTATTATACTGATATCGTTTCTAAGCATGCATTAAAACGTAGATTGATTCAAACTGCAGATAGTATTGCCAATGATGGATATAATGATGAACTTGAACTAGATGCGATTTTAAGTGATGCAGAACGTCGAATTTTAGAGCTATCATCTTCTCGTGAAAGCGATGGCTTTAAAGACATTCGAGACGTCTTAGGACAAGTGTATGAAACAGCTGAAGAGCTTGATCAAAATAGTGGTCAAACACCAGGTATACCTACAGGATATCGAGATTTAGACCAAATGACAGCAGGGTTCAACCGAAATGATTTAATTATCCTTGCAGCGCGTCCATCTGTAGGTAAGACTGCGTTCGCACTTAATATTGCACAAAAAGTTGCAACGCATGAAGATATGTATACAGTTGGTATTTTCTCGCTAGAGATGGGTGCTGATCAGTTAGCCACACGTATGATTTGTAGTTCTGGAAATGTTGACTCAAACCGCTTAAGAACGGGTACTATGACTGAGGAAGATTGGAGTCGTTTTACTATAGCGGTAGGTAAATTATCACGTACGAAGATTTTTATTGATGATACACCGGGTATTCGAATTAATGATTTACGTTCTAAATGTCGTCGATTAAAGCAAGAACATGGCTTAGACATGATTGTGATTGACTACTTACAGTTGATTCAAGGTAGTGGTTCACGTGCGTCCGATAACAGACAACAGGAAGTTTCTGAAATCTCTCGTACATTAAAAGCATTAGCCCGTGAATTAGAATGTCCAGTTATCGCATTAAGTCAGTTATCTCGTGGTGTTGAACAACGACAAGATAAACGTCCAATGATGAGTGATATTCGTGAATCTGGTTCGATTGAGCAAGATGCCGATATCGTTGCATTCTTATACCGTGATGATTACTATAACCGTGGCGGCGATGAAGATGATGACGATGATGGTGGTTTCGAGCCACAAACGAATGATGAAAACGGTGAAATTGAAATTATCATTGCTAAGCAACGTAACGGTCCAACAGGCACAGTTAAGTTACATTTTATGAAACAATATAATAAATTTACCGATATCGATTATGCACATGCAGATATGATGTAA
replicative DNA helicase4664.4176752571.3-0.5907733.6.4.12Genetic information processingDNA metabolismDNA replication, recombination, and repairreplicative DNA helicaseTIGR00665585.3PF03796DnaB_CDnaB-like helicase C terminal domainCL0023P-loop_NTPase383.9
NWMN_RS03640; NWMN_RS08905; NWMN_RS12340
Cytoplasmicno predicted signal peptide0446297792WP_000375647
MDRMYEQNQMPHNNEAEQSVLGSIIIDPELINTTQEVLLPESFYRGAHQHIFRAMMHLNEDNKEIDVVTLMDQLSTEGTLNEAGGPQYLAELSTNVPTTRNVQYYTDIVSKHALKRRLIQTADSIANDGYNDELELDAILSDAERRILELSSSRESDGFKDIRDVLGQVYETAEELDQNSGQTPGIPTGYRDLDQMTAGFNRNDLIILAARPSVGKTAFALNIAQKVATHEDMYTVGIFSLEMGADQLATRMICSSGNVDSNRLRTGTMTEEDWSRFTIAVGKLSRTKIFIDDTPGIRINDLRSKCRRLKQEHGLDMIVIDYLQLIQGSGSRASDNRQQEVSEISRTLKALARELECPVIALSQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNRGGDEDDDDDGGFEPQTNDENGEIEIIIAKQRNGPTGTVKLHFMKQYNKFTDIDYAHADMM
no data available 21166474
NWMN_RS15020S. aureus NewmanCDSNWMN_RS15020hypothetical proteinchromosome-2221722444228unknownWP_001802976
GTGAGCACCTCCAAGTTTTTCTCATTTAACCATTTGATATTCTACCAATATCGAGACCATAATGCAAATAAAAATCGAACATTGATTTTCGGCCTTTTTAAAAGAAAAATCATTTTAACAAATCGTTTTCAACGTCCTAAAAACCCTTTAACAGAGGCGTTGACAGTACTAATTTATCACTTTCAATACACAAACTTAACATATATCAACCCGTTCAGAACAAAATAA
hypothetical protein7511.15189192.62-0.438667Cytoplasmic Membraneno predicted signal peptide0WP_001802976
MSTSKFFSFNHLIFYQYRDHNANKNRTLIFGLFKRKIILTNRFQRPKNPLTEALTVLIYHFQYTNLTYINPFRTK
no data available
NWMN_RS00085NWMN_0016S. aureus NewmanSAUPAN000028000purACDSNWMN_RS00085adenylosuccinate synthetasechromosome+22445237281284unknownWP_000095327
ATGTCATCAATCGTAGTAGTTGGGACACAATGGGGAGACGAAGGAAAAGGAAAAATAACGGATTTCTTGGCAGAACAGTCAGATGTTATCGCGCGTTTTTCAGGTGGTAATAATGCAGGCCATACCATTCAATTTGGCGGAGAAACATATAAATTACATTTAGTACCATCTGGTATCTTTTACAAAGACAAATTAGCGGTAATCGGTAACGGAGTCGTTGTTGATCCAGTTGCACTATTGAAAGAATTAGACGGATTAAATGAACGTGGCATTCCTACAAGTAATTTACGTATATCTAATCGTGCGCAAGTGATTTTACCATATCACTTAGCACAAGATGAATATGAAGAACGTTTACGTGGTGACAATAAGATTGGTACAACTAAAAAAGGTATCGGTCCAGCATATGTAGACAAAGTTCAACGTATCGGTATTCGTATGGCAGATTTACTTGAAAAAGAAACATTCGAAAGATTATTAAAATCAAACATTGAATATAAACAAGCATATTTCAAAGGTATGTTTAACGAAACATGTCCATCATTTGATGATATCTTTGAAGAATATTATGCAGCAGGTCAACGTCTAAAAGAATTTGTAACAGACACATCAAAAATCTTAGACGATGCATTTGTAGCAGATGAAAAGGTACTTTTCGAAGGTGCGCAAGGTGTAATGTTAGATATCGACCATGGTACATATCCATTCGTTACATCAAGTAATCCAATTGCAGGTAACGTTACTGTTGGTACAGGTGTAGGTCCTACATTCGTTTCAAAGGTAATTGGTGTATGTAAAGCTTATACATCACGTGTTGGTGATGGTCCATTCCCTACTGAATTATTCGATGAAGATGGACATCATATTAGAGAGGTTGGTCGTGAATACGGTACAACAACAGGACGTCCACGTCGTGTAGGTTGGTTTGATTCAGTTGTATTACGTCACTCTCGTCGTGTAAGTGGTATTACAGATTTATCTATTAACTCAATCGATGTTTTAACAGGCCTAGACACAGTGAAAATCTGTACAGCTTATGAATTAGACGGTAAAGAAATTACTGAGTACCCAGCAAACTTAGATCAATTAAAACGTTGTAAACCAATCTTTGAAGAGTTACCAGGTTGGACAGAAGACGTAACAAATGTGCGTACTTTAGAAGAATTACCTGAAAATGCACGTAAATATTTAGAGCGTATTTCAGAATTATGTAATGTACAAATTTCTATCTTCTCAGTTGGTCCAGATAGAGAACAAACAAACCTATTAAAAGAATTGTGGTAG
adenylosuccinate synthetase4274.8564547578.4-0.3065576.3.4.4MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisadenylosuccinate synthaseTIGR00184595PF00709Adenylsucc_syntAdenylosuccinate synthetaseCL0023P-loop_NTPase588.1
NWMN_RS00075; NWMN_RS00315; NWMN_RS00885; NWMN_RS02020; NWMN_RS02030; NWMN_RS02105; NWMN_RS02135; NWMN_RS02150; NWMN_RS02715; NWMN_RS02815; NWMN_RS02910; NWMN_RS02915; NWMN_RS02920; NWMN_RS02925; NWMN_RS02940; NWMN_RS02950; NWMN_RS02955; NWMN_RS02960; NWMN_RS02965; NWMN_RS03160; NWMN_RS03425; NWMN_RS04075; NWMN_RS04195; NWMN_RS04200; NWMN_RS04205; NWMN_RS04215; NWMN_RS04380; NWMN_RS04440; NWMN_RS04590; NWMN_RS04675; NWMN_RS04700; NWMN_RS04730; NWMN_RS04935; NWMN_RS04955; NWMN_RS05320; NWMN_RS05325; NWMN_RS05380; NWMN_RS05390; NWMN_RS05395; NWMN_RS05970; NWMN_RS06210; NWMN_RS06445; NWMN_RS06475; NWMN_RS06490; NWMN_RS06575; NWMN_RS06585; NWMN_RS06665; NWMN_RS06840; NWMN_RS07035; NWMN_RS07080; NWMN_RS07120; NWMN_RS07455; NWMN_RS07515; NWMN_RS07760; NWMN_RS07785; NWMN_RS07800; NWMN_RS08000; NWMN_RS08215; NWMN_RS08350; NWMN_RS08675; NWMN_RS08685; NWMN_RS08795; NWMN_RS08820; NWMN_RS08830; NWMN_RS08865; NWMN_RS08905; NWMN_RS08930; NWMN_RS08935; NWMN_RS08950; NWMN_RS09045; NWMN_RS09125; NWMN_RS09385; NWMN_RS09790; NW
Cytoplasmicno predicted signal peptide0446017472WP_000095327
MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDG