(Redirected from JSNZ 000285)
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000285 [new locus tag: EGJ38_RS01425 ]
- pan locus tag?: SAUPAN001864000
- symbol: EGJ38_000285
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000285
- product: PTS sugar transporter subunit IIB
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000285 [new locus tag: EGJ38_RS01425 ]
- symbol: EGJ38_000285
- product: PTS sugar transporter subunit IIB
- replicon: chromosome
- strand: -
- coordinates: 321908..322192
- length: 285
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422288 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAAATTTTAGTAGTATGTGGCCACGGTTTAGGAAGTAGTTTTATGGTAGAAATGAAC
GCACAAGAAGCACTTAGGCAACTTAATGCACCATCTGATATCGAAGTTGAACATAGTGAC
ATTATGACAGCAAGTCCAGAGATGGCTGACTTGTTTATTTGTGGTAGAGATTTAGCTGAA
AATGCCGAACGTCTAGGGGATGTCTTAGTTCTTGATAATATTTTAGACAAAGCTGAATTA
CAACAAAAGCTCTCAGAAAAATTACAACAACTTAACATGATTTAA60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000285 [new locus tag: EGJ38_RS01425 ]
- symbol: EGJ38_000285
- description: PTS sugar transporter subunit IIB
- length: 94
- theoretical pI: 4.14695
- theoretical MW: 10398
- GRAVY: 0.0117021
⊟Function[edit | edit source]
- reaction: EC 2.7.1.-? ExPASy
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Phosphatase (CL0031) PTS_IIB; PTS system, Lactose/Cellobiose specific IIB subunit (PF02302; HMM-score: 56.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9985
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0
- Extracellular Score: 0.0012
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.093565
- TAT(Tat/SPI): 0.001196
- LIPO(Sec/SPII): 0.003942
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422288 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKILVVCGHGLGSSFMVEMNAQEALRQLNAPSDIEVEHSDIMTASPEMADLFICGRDLAENAERLGDVLVLDNILDKAELQQKLSEKLQQLNMI
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : ulaA < EGJ38_000285 < EGJ38_000286 < EGJ38_000287
⊟Regulation[edit | edit source]
- regulator: MepR (repression) regulon
MepR (TF) important in Multidrug resistance; regulation predicted or transferred from N315 and NCTC 8325 [2]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)