(Redirected from JSNZ 000819)
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000819 [new locus tag: EGJ38_RS04090 ]
- pan locus tag?: SAUPAN002931000
- symbol: EGJ38_000819
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000819
- product: DUF2483 family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000819 [new locus tag: EGJ38_RS04090 ]
- symbol: EGJ38_000819
- product: DUF2483 family protein
- replicon: chromosome
- strand: +
- coordinates: 843073..843294
- length: 222
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422794 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAGCAGACTGTAACTTATATCATTCGTCATAGAGATATGCCAATTTATATAACTAAC
AAACCAACCGATAACAATTCAGATATTAGTTACTCCACAAATAGAAATAGAGCTAGGGAG
TTTAACGGTATGGAAGAAGCGAGTATCAATATGGATTATCACAAAGCAATCAAGAAAACA
GTGACAGAAACTATTGAGTACGAGGAGGTAGAACATGACTGA60
120
180
222
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000819 [new locus tag: EGJ38_RS04090 ]
- symbol: EGJ38_000819
- description: DUF2483 family protein
- length: 73
- theoretical pI: 5.61103
- theoretical MW: 8698.6
- GRAVY: -1.09041
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined DUF2483; Hypothetical protein of unknown function (DUF2483) (PF10656; HMM-score: 104.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6224
- Cytoplasmic Membrane Score: 0.0023
- Cell wall & surface Score: 0.0025
- Extracellular Score: 0.3728
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008309
- TAT(Tat/SPI): 0.000355
- LIPO(Sec/SPII): 0.000984
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422794 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKQTVTYIIRHRDMPIYITNKPTDNNSDISYSTNRNRAREFNGMEEASINMDYHKAIKKTVTETIEYEEVEHD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000818 > EGJ38_000819 > EGJ38_000820 > ssb2 > EGJ38_000822 > EGJ38_000823
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)