(Redirected from JSNZ 001077)
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001077 [new locus tag: EGJ38_RS05380 ]
- pan locus tag?: SAUPAN003339000
- symbol: fpa
- pan gene symbol?: fpa
- synonym: ylaN
- alternate name: JSNZ_001077
- product: DUF1507 family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001077 [new locus tag: EGJ38_RS05380 ]
- symbol: fpa
- product: DUF1507 family protein
- replicon: chromosome
- strand: +
- coordinates: 1080532..1080807
- length: 276
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423046 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCGAAACAAGCAACAATGAAAAATGCAGCTTTGAAACAATTGACTAAAGATGCTGAT
GAAATCTTGCATCTGATTAAAGTTCAACTAGATAATTTAACATTACCTTCATGCCCATTA
TATGAAGAAGTACTAGATACACAAATGTTTGGACTTCAAAAAGAAGTTGATTTTGCTGTT
AAATTAGGTTTAGTTGACCGCGAAGATGGCAAACAAATTATGTTACGTCTTGAGAAAGAA
CTTTCAAAATTACATGAAGCTTTTACACTTGTTTAA60
120
180
240
276
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001077 [new locus tag: EGJ38_RS05380 ]
- symbol: Fpa
- description: DUF1507 family protein
- length: 91
- theoretical pI: 5.13718
- theoretical MW: 10355.1
- GRAVY: -0.124176
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined DUF1507; Protein of unknown function (DUF1507) (PF07408; HMM-score: 124.8)and 2 moreDUF2680; Protein of unknown function (DUF2680) (PF10925; HMM-score: 17.3)Nas2_N; Nas2 N_terminal domain (PF18265; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8031
- Cytoplasmic Membrane Score: 0.0376
- Cell wall & surface Score: 0.0015
- Extracellular Score: 0.1577
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000996
- TAT(Tat/SPI): 0.000153
- LIPO(Sec/SPII): 0.000191
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423046 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSKLHEAFTLV
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]