From AureoWiki
(Redirected from JSNZ 001427)
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001427 [new locus tag: EGJ38_RS07125 ]
  • pan locus tag?: SAUPAN003899000
  • symbol: EGJ38_001427
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_001427
  • product: DUF4889 domain-containing protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001427 [new locus tag: EGJ38_RS07125 ]
  • symbol: EGJ38_001427
  • product: DUF4889 domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1474959..1475291
  • length: 333
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423388 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGGTAAAAAAATGGGTCTAGGTTTATCTATTGCATTGATTGTTATTGGTATTGCCGTT
    GTATGTTTAATGATTTTTTCTAGTCAAAAAACGACTTATTTTGGTTATATGAATAGTAAT
    ACAAATGCAGAAAAAGTTGTAAGTGAAAAAGATGGATTAGTCAAACATAATATCAAAGTA
    GAACCATCTAATGATTTCAAGCCGAAAAAAGGAGACTTTGTAAAATTAGTTTCTAAAGAT
    GATGGGAAGACATTTTATAAACAAGAGATTGTTAAACATGATGACGTCCCACACGGTTTA
    ATGATGAAAATTCACGACATGCATATGAATTAA
    60
    120
    180
    240
    300
    333


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001427 [new locus tag: EGJ38_RS07125 ]
  • symbol: EGJ38_001427
  • description: DUF4889 domain-containing protein
  • length: 110
  • theoretical pI: 9.72436
  • theoretical MW: 12330.5
  • GRAVY: -0.210909

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined DUF4889; Domain of unknown function (DUF4889) (PF16230; HMM-score: 131.3)
    and 4 more
    DUF3139; Protein of unknown function (DUF3139) (PF11337; HMM-score: 14.7)
    OB (CL0021) YqiJ_OB; Inner membrane protein YqiJ, OB-fold (PF07290; HMM-score: 13.5)
    SLATT (CL0676) SLATT_6; SMODS and SLOG-associating 2TM effector domain 6 (PF18169; HMM-score: 13.3)
    no clan defined BssC_TutF; BssC/TutF protein (PF08201; HMM-score: 12.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.8723
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.1269
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 21 aa
    • SP(Sec/SPI): 0.325152
    • TAT(Tat/SPI): 0.001355
    • LIPO(Sec/SPII): 0.346676
    • Cleavage Site: CS pos: 21-22. AVV-CL. Pr: 0.2370
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423388 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MGKKMGLGLSIALIVIGIAVVCLMIFSSQKTTYFGYMNSNTNAEKVVSEKDGLVKHNIKVEPSNDFKPKKGDFVKLVSKDDGKTFYKQEIVKHDDVPHGLMMKIHDMHMN

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]