From AureoWiki
(Redirected from JSNZ 002233)
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002233 [new locus tag: EGJ38_RS11145 ]
  • pan locus tag?: SAUPAN005724000
  • symbol: sarV
  • pan gene symbol?: sarV
  • synonym:
  • alternate name: JSNZ_002233
  • product: HTH-type transcriptional regulator SarV

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002233 [new locus tag: EGJ38_RS11145 ]
  • symbol: sarV
  • product: HTH-type transcriptional regulator SarV
  • replicon: chromosome
  • strand: -
  • coordinates: 2234902..2235252
  • length: 351
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424121 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAGTAATAAAGTTCAACGTTTTATAGAAGCAGAAAGGGAGTTAAGTCAGTTAAAGCAC
    TGGTTAAAAACAACACATAAGATTTCAATTGAAGAATTTGTAGTACTTTTTAAAGTGTAT
    GAAGCTGAAAAGATTAGCGGTAAAGAATTGAGGGATACATTACATTTTGAAATGCTATGG
    GATACAAGTAAAATCGATGTGATTATCCGTAAAATCTATAAAAAAGAGCTTATTTCTAAA
    TTGCGTTCTGAAACGGATGAAAGACAAGTATTCTATTTCTATAGTACTTCTCAAAAGAAA
    TTGTTAGATAAAATTACTAAAGAAATAGAAGTGTTAAGCGTTACAAACTAA
    60
    120
    180
    240
    300
    351

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002233 [new locus tag: EGJ38_RS11145 ]
  • symbol: SarV
  • description: HTH-type transcriptional regulator SarV
  • length: 116
  • theoretical pI: 9.64293
  • theoretical MW: 13986.2
  • GRAVY: -0.47069

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 86.5)
    and 4 more
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 21.5)
    Signal transduction Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 21.5)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 19.4)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism nrdI protein (TIGR00333; HMM-score: 13.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 75.1)
    and 8 more
    MarR; MarR family (PF01047; HMM-score: 27.3)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 18.5)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 18.4)
    DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 17.7)
    no clan defined SBDS_N; Shwachman-Bodian-Diamond syndrome (SBDS) N-terminal domain (PF01172; HMM-score: 17.1)
    GatB_YqeY (CL0279) GatB_Yqey; GatB domain (PF02637; HMM-score: 15)
    no clan defined DUF4874; Domain of unknown function (DUF4874) (PF16173; HMM-score: 14.3)
    GT-B (CL0113) Glyco_transf_28; Glycosyltransferase family 28 N-terminal domain (PF03033; HMM-score: 13.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.912
    • Cytoplasmic Membrane Score: 0.0545
    • Cell wall & surface Score: 0.0009
    • Extracellular Score: 0.0326
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000785
    • TAT(Tat/SPI): 0.00015
    • LIPO(Sec/SPII): 0.000157
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424121 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSNKVQRFIEAERELSQLKHWLKTTHKISIEEFVVLFKVYEAEKISGKELRDTLHFEMLWDTSKIDVIIRKIYKKELISKLRSETDERQVFYFYSTSQKKLLDKITKEIEVLSVTN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]