From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1837 [new locus tag: SA_RS10540 ]
  • pan locus tag?: SAUPAN005266000
  • symbol: groES
  • pan gene symbol?: groES
  • synonym:
  • product: co-chaperonin GroES

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1837 [new locus tag: SA_RS10540 ]
  • symbol: groES
  • product: co-chaperonin GroES
  • replicon: chromosome
  • strand: -
  • coordinates: 2074033..2074317
  • length: 285
  • essential: yes DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCTAAAACCAATTGGAAATCGTGTGATTATTGAGAAAAAAGAACAAGAACAAACAACT
    AAAAGTGGTATTGTTTTAACTGATAGTGCTAAAGAAAAATCAAACGAAGGCGTTATCGTT
    GCAGTAGGAACTGGACGTCTATTAAATGATGGTACAAGAGTGACTCCTGAAGTGAAAGAA
    GGGGACCGTGTCGTGTTCCAACAATATGCTGGTACAGAAGTTAAACGAGATAATGAAACA
    TATCTAGTATTAAATGAAGAAGATATTTTAGCGGTAATTGAATAA
    60
    120
    180
    240
    285

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1837 [new locus tag: SA_RS10540 ]
  • symbol: GroES
  • description: co-chaperonin GroES
  • length: 94
  • theoretical pI: 4.57199
  • theoretical MW: 10415.7
  • GRAVY: -0.439362

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Heat shock protein 10 kDa family chaperone GroES
    Protein Metabolism Protein folding GroEL GroES  Heat shock protein 60 family co-chaperone GroES
  • PFAM:
    GroES (CL0296) Cpn10; Chaperonin 10 Kd subunit (PF00166; HMM-score: 117.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006421
    • TAT(Tat/SPI): 0.000738
    • LIPO(Sec/SPII): 0.001003
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLKPIGNRVIIEKKEQEQTTKSGIVLTDSAKEKSNEGVIVAVGTGRLLNDGTRVTPEVKEGDRVVFQQYAGTEVKRDNETYLVLNEEDILAVIE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulators: CtsR (repression) regulon, HrcA (repression) regulon
    CtsR(TF)important in Heat shock response; RegPrecise 
    HrcA(TF)important in Heat shock response; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)