Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1824 [new locus tag: SACOL_RS09350 ]
- pan locus tag?: SAUPAN004465000
- symbol: arsC
- pan gene symbol?: arsC
- synonym:
- product: arsenate reductase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1824 [new locus tag: SACOL_RS09350 ]
- symbol: arsC
- product: arsenate reductase
- replicon: chromosome
- strand: +
- coordinates: 1880090..1880485
- length: 396
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236010 NCBI
- RefSeq: YP_186656 NCBI
- BioCyc: see SACOL_RS09350
- MicrobesOnline: 913268 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGACTAAAAAAACAATTTATTTTATATGTACAGGCAACTCATGTCGAAGTCAAATGGCT
GAAGGTTGGGCTAAACAAATCTTAGCGGATGATTGGAATGTATATTCTGCTGGTATCGAA
ACACACGGTGTTAATCCCAAAGCGATAGAAGCTATGAAAGAAGTAGGCATTGATATATCA
AATCATACATCAGATTTAATCGATAATAATATTATTAAAAATTCAAATTTAGTTGTTACA
TTATGTAGTGATGCAGACGTAAATTGCCCTTCTTTACCAACAAATGTTAAGAAAGAACAT
TGGGGATTTGATGATCCTGCAGGCAAGCCTTGGTCAGAGTTCCAACGTGTAAGAGATGAA
ATTAAAATCGCAATTGAAAATTTCAAATCACGATGA60
120
180
240
300
360
396
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1824 [new locus tag: SACOL_RS09350 ]
- symbol: ArsC
- description: arsenate reductase
- length: 131
- theoretical pI: 5.66473
- theoretical MW: 14686.5
- GRAVY: -0.444275
⊟Function[edit | edit source]
- reaction: EC 1.20.4.4? ExPASyArsenate reductase (thioredoxin) Arsenate + thioredoxin = arsenite + thioredoxin disulfide + H2O
- TIGRFAM: Cellular processes Detoxification arsenate reductase (thioredoxin) (TIGR02691; EC 1.20.4.-,3.1.3.48; HMM-score: 204.4)and 1 moreCellular processes Detoxification arsenate reductase, glutathione/glutaredoxin type (TIGR02689; EC 1.20.4.1; HMM-score: 104.8)
- TheSEED :
- Arsenate reductase (EC 1.20.4.1)
Respiration Electron accepting reactions Anaerobic respiratory reductases Arsenate reductase (EC 1.20.4.1)and 1 more - PFAM: Phosphatase (CL0031) LMWPc; Low molecular weight phosphotyrosine protein phosphatase (PF01451; HMM-score: 86.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.051357
- TAT(Tat/SPI): 0.000618
- LIPO(Sec/SPII): 0.016696
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKKTIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHGVNPKAIEAMKEVGIDISNHTSDLIDNNIIKNSNLVVTLCSDADVNCPSLPTNVKKEHWGFDDPAGKPWSEFQRVRDEIKIAIENFKSR
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 48 [3]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: arsR > arsB > arsC
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]