Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0050 [new locus tag: SAUSA300_RS00265 ]
- pan locus tag?: SAUPAN000803000
- symbol: SAUSA300_0050
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0050 [new locus tag: SAUSA300_RS00265 ]
- symbol: SAUSA300_0050
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 60849..61187
- length: 339
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3913087 NCBI
- RefSeq: YP_492770 NCBI
- BioCyc: GH3C-50 BioCyc
- MicrobesOnline: 1291565 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCATAAAAATGACAATAGTTACGTTTTATCAGCATTGAGTTATTTAAGTATCTTTTTC
GCACCTGTCATTTTACCTTTATTTGTATGGATACTTGCTGATGAACCAACATCAGAACAT
GGCAAAAAAGCATTCATTAATCATATTATGACTTGGGTTAGTCTTTTTATAGGTAGATTG
GCATTTATTTTTTCTAAAGAAGTCTTTGATAAACCTTTGGATCATCAATTATTAATATTT
AGCATTCTTTTAATTATTACTATTATATTCTTTTTAATTGCTTTAATATTATATATCTTG
AACATTAACAGAGGAATTAAAATTCTATTAAAAAAATAA60
120
180
240
300
339
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0050 [new locus tag: SAUSA300_RS00265 ]
- symbol: SAUSA300_0050
- description: hypothetical protein
- length: 112
- theoretical pI: 9.89698
- theoretical MW: 12975.6
- GRAVY: 0.926786
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01109476: hypothetical protein
- PFAM: no clan defined DUF4870; Domain of unknown function (DUF4870) (PF09685; HMM-score: 22.3)and 4 moreTMEM43; Transmembrane protein 43 (PF07787; HMM-score: 11)DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 10.5)PGG; Domain of unknown function (PF13962; HMM-score: 10.1)DUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 7.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.093889
- TAT(Tat/SPI): 0.005176
- LIPO(Sec/SPII): 0.005383
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MHKNDNSYVLSALSYLSIFFAPVILPLFVWILADEPTSEHGKKAFINHIMTWVSLFIGRLAFIFSKEVFDKPLDHQLLIFSILLIITIIFFLIALILYILNINRGIKILLKK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.