Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07560 [old locus tag: SAUSA300_1385 ]
- pan locus tag?: SAUPAN001710000
- symbol: SAUSA300_RS07560
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07560 [old locus tag: SAUSA300_1385 ]
- symbol: SAUSA300_RS07560
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1550380..1550679
- length: 300
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1550380..1550679) NCBI
- BioCyc: see SAUSA300_1385
- MicrobesOnline: see SAUSA300_1385
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTTGGATTTACCAAACGACACGAACAAGATTGGCGTTTAACGCGATTAGAAGAAAAT
GATAAGACTATGTTTGAAAAATTCGACAGAATAGAAGACAGTCTGAGAACGCAAGAAAAA
ATTTATGACAAGTTAGATAGAAATTTCGAAGAACTAAGGCGTGACAAAGAAGAAGATGAA
AAAAATAAAGAGAAAAATGCTAAAAATATTAGAGACATCAAGATGTGGATTCTAGGATTA
ATAGGGACGATTCTAAGTACATTTGTTATAGCCTTGTTAAAAACTATTTTTGGCATTTAA60
120
180
240
300
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07560 [old locus tag: SAUSA300_1385 ]
- symbol: SAUSA300_RS07560
- description: hypothetical protein
- length: 99
- theoretical pI: 7.54141
- theoretical MW: 12084.8
- GRAVY: -0.844444
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 8.8)
- TheSEED: see SAUSA300_1385
- PFAM: no clan defined DUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 185.6)and 7 moreXhlA; Haemolysin XhlA (PF10779; HMM-score: 20.2)GOLD-like (CL0521) EMP24_GP25L; emp24/gp25L/p24 family/GOLD (PF01105; HMM-score: 14.1)no clan defined TelA; Toxic anion resistance protein (TelA) (PF05816; HMM-score: 14)DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 13.9)DUF3452; Domain of unknown function (DUF3452) (PF11934; HMM-score: 13.7)YabB; Initiation control protein YabA (PF06156; HMM-score: 12.2)PRP1_N; PRP1 splicing factor, N-terminal (PF06424; HMM-score: 9.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.78
- Cytoplasmic Membrane Score: 8.16
- Cellwall Score: 0.06
- Extracellular Score: 0.01
- Internal Helix: 1
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002507
- TAT(Tat/SPI): 0.001889
- LIPO(Sec/SPII): 0.001011
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI: 446388929 NCBI
- RefSeq: WP_000466784 NCBI
- UniProt: see SAUSA300_1385
⊟Protein sequence[edit | edit source]
- MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRTQEKIYDKLDRNFEELRRDKEEDEKNKEKNAKNIRDIKMWILGLIGTILSTFVIALLKTIFGI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.