Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS09870 [old locus tag: SAUSA300_1803 ]
- pan locus tag?: SAUPAN004789000
- symbol: SAUSA300_RS09870
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS09870 [old locus tag: SAUSA300_1803 ]
- symbol: SAUSA300_RS09870
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1986965..1987117
- length: 153
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1986965..1987117) NCBI
- BioCyc: see SAUSA300_1803
- MicrobesOnline: see SAUSA300_1803
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACG
GATTTTGAAGATTTAAAAGAATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGAT
CAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS09870 [old locus tag: SAUSA300_1803 ]
- symbol: SAUSA300_RS09870
- description: hypothetical protein
- length: 50
- theoretical pI: 3.89627
- theoretical MW: 5936.25
- GRAVY: -1.87
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1803
- PFAM: THBO-biosyn (CL0334) PTPS; 6-pyruvoyl tetrahydropterin synthase (PF01242; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.027561
- TAT(Tat/SPI): 0.011381
- LIPO(Sec/SPII): 0.007759
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 445953253 NCBI
- RefSeq: WP_000031108 NCBI
- UniProt: see SAUSA300_1803
⊟Protein sequence[edit | edit source]
- MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.