Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS13730 [old locus tag: SAUSA300_2474 ]
- pan locus tag?: SAUPAN006190000
- symbol: SAUSA300_RS13730
- pan gene symbol?: —
- synonym:
- product: thiol reductase thioredoxin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS13730 [old locus tag: SAUSA300_2474 ]
- symbol: SAUSA300_RS13730
- product: thiol reductase thioredoxin
- replicon: chromosome
- strand: -
- coordinates: 2671100..2671444
- length: 345
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2671100..2671444) NCBI
- BioCyc: see SAUSA300_2474
- MicrobesOnline: see SAUSA300_2474
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGTTAAGCAATTAAATAGTGTCGAAGCATTCCGTGAATTTATTCATCAATATCCGTTA
GCAGTTGTACATGTCATGCGCGATCAGTGTAGCGTGTGTCATGCCGTTTTACCACAAATT
GAAGACTTGATGCAATCATATCCCAATGTGCCATTAGCTGTGATTAATCAAAGTCAGGTG
GAAGCTATTGCTGGAGAATTAAATATTTTCACTGTACCTGTGGATTTAATTTTTATGAAT
GGAAAAGAAATGCATCGTCAAGGGCGTTTTATCGATATGCAACGTTTTGAACATCATCTT
AAGCAAATGAATGATAGTGTAAATAACGATGTCGATGAGCATTAA60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS13730 [old locus tag: SAUSA300_2474 ]
- symbol: SAUSA300_RS13730
- description: thiol reductase thioredoxin
- length: 114
- theoretical pI: 5.4387
- theoretical MW: 13215.1
- GRAVY: -0.192982
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 32.8)and 1 moretype-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB (TIGR02738; HMM-score: 12.6)
- TheSEED: see SAUSA300_2474
- PFAM: Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 33)and 5 moreThioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 17.7)CDA (CL0109) Toxin-deaminase; The BURPS668_1122 family of deaminases (PF14424; HMM-score: 12.8)Cytochrome-c (CL0318) Cytochrom_C1; Cytochrome C1 family (PF02167; HMM-score: 12.6)LDH_C (CL0341) Ldh_1_C; lactate/malate dehydrogenase, alpha/beta C-terminal domain (PF02866; HMM-score: 12.1)Thioredoxin (CL0172) Phosducin; Phosducin (PF02114; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007366
- TAT(Tat/SPI): 0.001573
- LIPO(Sec/SPII): 0.001509
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446162807 NCBI
- RefSeq: WP_000240662 NCBI
- UniProt: see SAUSA300_2474
⊟Protein sequence[edit | edit source]
- MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQVEAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.