From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS01215 [old locus tag: SA0206 ]
  • pan locus tag?: SAUPAN001064000
  • symbol: SA_RS01215
  • pan gene symbol?: malK
  • synonym:
  • product: sugar ABC transporter ATP-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS01215 [old locus tag: SA0206 ]
  • symbol: SA_RS01215
  • product: sugar ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 244449..245546
  • length: 1098
  • essential: yes DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (244449..245546) NCBI
  • BioCyc: G1G21-220 BioCyc
  • MicrobesOnline: see SA0206

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGGCAGAACTAAAGTTAGAGCATATTAAAAAGACGTATGATAACAACAATACTGTAGTG
    AAAGATTTTAATCTACATATTACTGACAAAGAATTCATTGTATTTGTTGGACCATCGGGA
    TGTGGTAAATCAACAACATTACGAATGGTTGCTGGACTAGAGTCTATCACATCTGGAGAT
    TTTTATATTGATGGGGAACGCATGAACGATGTTGAACCAAAGAATAGAGATATTGCGATG
    GTATTTCAAAACTATGCATTATATCCACATATGACTGTATTTGAAAATATGGCATTTGGG
    CTAAAGCTACGTAAAGTAAATAAAAAAGAGATTGAACAAAAAGTCAATGAAGCAGCTGAA
    ATATTAGGATTAACTGAGTATCTTGGTCGTAAACCAAAAGCGTTATCTGGTGGACAGCGT
    CAACGTGTTGCTTTGGGCAGAGCTATTGTTAGGGATGCGAAAGTCTTTTTAATGGATGAA
    CCATTATCGAATCTTGATGCGAAGCTTCGAGTACAAATGCGCACAGAAATATTGAAATTA
    CATAAGCGACTTAATACTACGACAATTTATGTTACACATGATCAAACTGAAGCATTGACG
    ATGGCTAGTCGAATTGTTGTTTTGAAAGATGGCGACATTATGCAAGTCGGCACACCTAGA
    GAAATATATGATGCCCCTAATTGCATATTTGTGGCGCAATTTATCGGCTCACCAGCAATG
    AATATGTTGAATGCTACAGTTGAAATGGACGGATTGAAGGTAGGAACACATCATTTTAAA
    TTACATAATAAAAAATTTGAAAAGTTAAAAGCTGCTGGCTACTTAGACAAGGAAATTATT
    TTAGGTATTCGAGCTGAAGACATTCATGAAGAACCAATATTTATTCAAACTTCTCCAGAG
    ACACAATTTGAATCTGAAGTAGTTGTATCCGAGTTGTTAGGTTCAGAAATCATGGTACAT
    AGTACATTCCAAGGAATGGAATTGATTTCTAAATTAGATTCAAGAACCCAAGTGATGACG
    AACGACAAGATTACACTAGCATTTGATATGAATAAGTGTCACTTTTTTGATGAAAAAACA
    GGAAATCGTATCGTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1098

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS01215 [old locus tag: SA0206 ]
  • symbol: SA_RS01215
  • description: sugar ABC transporter ATP-binding protein
  • length: 365
  • theoretical pI: 6.91775
  • theoretical MW: 41364.6
  • GRAVY: -0.250137

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 326.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 310.2)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 263)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 261.8)
    and 70 more
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 240.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 206)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 184.4)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 174.9)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 174.8)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 163.5)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 161)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 159.7)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 159.7)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 151.8)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 151.8)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 149.8)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 144.9)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 143.9)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 142.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 137.3)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 135.5)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 132.2)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 130.6)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 126.9)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 124)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 123.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 123.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 123)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 123)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 120.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 120.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 119.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 119.5)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 115.4)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 115.4)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 106.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 106.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 106.5)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 105.7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 105.7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 105.1)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 103.2)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 102.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 102)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 101.5)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 101.5)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 100.3)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 99.5)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 99.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 98.9)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 98.9)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 98.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 96.3)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 83.4)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 81.6)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 81.6)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 77.3)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 76.4)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 75.6)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 69.6)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 68.7)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 67.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 66.5)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 66.5)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 64.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 54.5)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 51.8)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 50.5)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 49.3)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 38)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 34.1)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 17)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 15.6)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.9)
  • TheSEED: see SA0206
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 102.6)
    and 16 more
    OB (CL0021) TOBE; TOBE domain (PF03459; HMM-score: 41.7)
    P-loop_NTPase (CL0023) AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 26.4)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 25.2)
    OB (CL0021) TOBE_2; TOBE domain (PF08402; HMM-score: 20.3)
    P-loop_NTPase (CL0023) Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 19.9)
    AAA_22; AAA domain (PF13401; HMM-score: 18.1)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.6)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 16.8)
    AAA_23; AAA domain (PF13476; HMM-score: 16.3)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.6)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 15.6)
    AAA_18; AAA domain (PF13238; HMM-score: 15)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 14.8)
    AAA_33; AAA domain (PF13671; HMM-score: 14)
    AAA_28; AAA domain (PF13521; HMM-score: 13.1)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 12.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.04
    • Cytoplasmic Membrane Score: 9.96
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008572
    • TAT(Tat/SPI): 0.001234
    • LIPO(Sec/SPII): 0.004169
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAELKLEHIKKTYDNNNTVVKDFNLHITDKEFIVFVGPSGCGKSTTLRMVAGLESITSGDFYIDGERMNDVEPKNRDIAMVFQNYALYPHMTVFENMAFGLKLRKVNKKEIEQKVNEAAEILGLTEYLGRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRTEILKLHKRLNTTTIYVTHDQTEALTMASRIVVLKDGDIMQVGTPREIYDAPNCIFVAQFIGSPAMNMLNATVEMDGLKVGTHHFKLHNKKFEKLKAAGYLDKEIILGIRAEDIHEEPIFIQTSPETQFESEVVVSELLGSEIMVHSTFQGMELISKLDSRTQVMTNDKITLAFDMNKCHFFDEKTGNRIV

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: CcpA, MalR see SA0206

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]