From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS08065 [old locus tag: SA1429 ]
  • pan locus tag?: SAUPAN004189000
  • symbol: SA_RS08065
  • pan gene symbol?:
  • synonym:
  • product: carboxylate--amine ligase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS08065 [old locus tag: SA1429 ]
  • symbol: SA_RS08065
  • product: carboxylate--amine ligase
  • replicon: chromosome
  • strand: -
  • coordinates: 1632274..1632513
  • length: 240
  • essential: no DEG

Accession numbers[edit | edit source]

  • Location: NC_002745 (1632274..1632513) NCBI
  • BioCyc: G1G21-1621 BioCyc
  • MicrobesOnline: see SA1429

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATTCAAGAATTAGATGTTCAATTAAGAAATTATTTGAATGAGAAGTATAAGTTGTACGAA
    CAAGGTGGCGACATTGTTAAAGGGTATGTTAAATATCATAATGATGATGAACAAAATGTA
    GAATATGATTTTTATAATTTAAATGGTGAGTATGGTTATGAGGTATTAAAAATGTATGCT
    GATAATAAAACTATCAATAGAGACAAATTGCATTTAGATATCTATTTATTCAAATCATAA
    60
    120
    180
    240

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS08065 [old locus tag: SA1429 ]
  • symbol: SA_RS08065
  • description: carboxylate--amine ligase
  • length: 79
  • theoretical pI: 4.61375
  • theoretical MW: 9629.63
  • GRAVY: -1

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA1429
  • PFAM:
    Ant-toxin_C (CL0386) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 95.4)
    and 1 more
    Arrestin_N-like (CL0135) Bul1_N; Bul1 N terminus (PF04425; HMM-score: 14)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.72
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.041668
    • TAT(Tat/SPI): 0.000403
    • LIPO(Sec/SPII): 0.003014
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MQELDVQLRNYLNEKYKLYEQGGDIVKGYVKYHNDDEQNVEYDFYNLNGEYGYEVLKMYADNKTINRDKLHLDIYLFKS

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]