NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1574 [new locus tag: SACOL_RS08020 ]
- pan locus tag?: SAUPAN004090000
- symbol: SACOL1574
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1574 [new locus tag: SACOL_RS08020 ]
- symbol: SACOL1574
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1609250..1609591
- length: 342
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3237304 NCBI
- RefSeq: YP_186414 NCBI
- BioCyc: see SACOL_RS08020
- MicrobesOnline: 913023 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAGGCGATGGTTTGTATTAATTTTAGGATTAGTTATATTATTATCTGCATGTGGTCAG
AAATATGATAAAGAGATTGATGCAGTTTTAAATTCTGAAAGAAAAAGTATGAGTGAGTCT
TCTTTTAAGAAGCCTGAAAAAAGTAATAGTGATTTTAAAGTATATGAAGATGGTAAATTT
ATAACTATTTCTTTTGTTTATGATAAAGATGGTACAGTGTGGACAAGTTTATATAAAAAG
AATGAGACAACAGATAAATATGTAAAAGTTGAAGATATGAATGAAAAAGAATATCAAAGT
AATCATAAACCAGTTTATGAAGAAAATAATATGAAAAAATAA60
120
180
240
300
342
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1574 [new locus tag: SACOL_RS08020 ]
- symbol: SACOL1574
- description: hypothetical protein
- length: 113
- theoretical pI: 8.38694
- theoretical MW: 13355.1
- GRAVY: -0.835398
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- ⊞PFAM: NTF2 (CL0051) DUF4467; Domain of unknown function with cystatin-like fold (DUF4467) (PF14729; HMM-score: 36.1)and 3 more
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRRWFVLILGLVILLSACGQKYDKEIDAVLNSERKSMSESSFKKPEKSNSDFKVYEDGKFITISFVYDKDGTVWTSLYKKNETTDKYVKVEDMNEKEYQSNHKPVYEENNMKK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Lipoprotein [1] [2] [3] [4]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)