⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000020 [new locus tag: EGJ38_RS00100 ]
- pan locus tag?: SAUPAN000032000
- symbol: walR
- pan gene symbol?: walR
- synonym: JSNZ_000020
- product: response regulator YycF
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000020 [new locus tag: EGJ38_RS00100 ]
- symbol: walR
- product: response regulator YycF
- replicon: chromosome
- strand: +
- coordinates: 24403..25104
- length: 702
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422032 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTT
AACTTAAAAAAAGAAGGATACGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGAC
TTAATTTATGAAGAAGAACCAGACATCGTATTATTAGATATCATGTTACCTGGTCGTGAT
GGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATTATAATGCTTACT
GCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTA
ACGAAACCGTTTAGTACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCAT
TACTCACAACCAGCACAAGACACTGGAAATGTAACGAATGAAATCACAATTAAAGATATT
GTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTAACACAT
CGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAA
CATTTATTACAAACAGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTA
ACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGTCACACCCTGAATATATTGTG
ACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG60
120
180
240
300
360
420
480
540
600
660
702
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000020 [new locus tag: EGJ38_RS00100 ]
- symbol: WalR
- description: response regulator YycF
- length: 233
- theoretical pI: 4.81211
- theoretical MW: 27191.8
- GRAVY: -0.475536
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 235.8)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 235.8)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 191.9)and 7 moreproteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 132.5)Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.6)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.6)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.6)Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 69.4)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 41.1)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 40.3)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 107.1)HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 102.8)and 1 moreCheY (CL0304) VpsR; VpsR domain (PF20161; HMM-score: 15.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: WalK (sensor histidine kinase)
- genes regulated by WalR/JSNZ_000020, response regulator important in cell wall homeostasis [1] [2]
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9911
- Cytoplasmic Membrane Score: 0.007
- Cell wall & surface Score: 0
- Extracellular Score: 0.0019
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004145
- TAT(Tat/SPI): 0.000213
- LIPO(Sec/SPII): 0.000302
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422032 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: Rex/JSNZ_002000 (repression) regulon
Rex/JSNZ_002000 (TF) important in Energy metabolism; regulation predicted or transferred from N315 and NCTC 8325 [4]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Sarah Dubrac, Ivo Gomperts Boneca, Olivier Poupel, Tarek Msadek
New insights into the WalK/WalR (YycG/YycF) essential signal transduction pathway reveal a major role in controlling cell wall metabolism and biofilm formation in Staphylococcus aureus.
J Bacteriol: 2007, 189(22);8257-69
[PubMed:17827301] [WorldCat.org] [DOI] (I p) - ↑ Aurélia Delauné, Sarah Dubrac, Charlène Blanchet, Olivier Poupel, Ulrike Mäder, Aurélia Hiron, Aurélie Leduc, Catherine Fitting, Pierre Nicolas, Jean-Marc Cavaillon, Minou Adib-Conquy, Tarek Msadek
The WalKR system controls major staphylococcal virulence genes and is involved in triggering the host inflammatory response.
Infect Immun: 2012, 80(10);3438-53
[PubMed:22825451] [WorldCat.org] [DOI] (I p) - ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Sarah Dubrac, Tarek Msadek
Identification of genes controlled by the essential YycG/YycF two-component system of Staphylococcus aureus.
J Bacteriol: 2004, 186(4);1175-81
[PubMed:14762013] [WorldCat.org] [DOI] (P p)Sarah Dubrac, Ivo Gomperts Boneca, Olivier Poupel, Tarek Msadek
New insights into the WalK/WalR (YycG/YycF) essential signal transduction pathway reveal a major role in controlling cell wall metabolism and biofilm formation in Staphylococcus aureus.
J Bacteriol: 2007, 189(22);8257-69
[PubMed:17827301] [WorldCat.org] [DOI] (I p)Aurélia Delauné, Sarah Dubrac, Charlène Blanchet, Olivier Poupel, Ulrike Mäder, Aurélia Hiron, Aurélie Leduc, Catherine Fitting, Pierre Nicolas, Jean-Marc Cavaillon, Minou Adib-Conquy, Tarek Msadek
The WalKR system controls major staphylococcal virulence genes and is involved in triggering the host inflammatory response.
Infect Immun: 2012, 80(10);3438-53
[PubMed:22825451] [WorldCat.org] [DOI] (I p)