Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000030 [new locus tag: EGJ38_RS00150 ]
- pan locus tag?: SAUPAN000782000
- symbol: EGJ38_000030
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000030
- product: IS21 family transposase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000030 [new locus tag: EGJ38_RS00150 ]
- symbol: EGJ38_000030
- product: IS21 family transposase
- replicon: chromosome
- strand: +
- coordinates: 38526..38747
- length: 222
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422042 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGAGACATGACATTTATGAAGGAGTGCTATTTTACCTTATGAAAGGTATTAAACCAAAT
TATGCTGAGCTTGGTCGACAATATAATTGTGATCCAAGAACAGTTAAAAAATATTATGAA
GCAGGAAAAGAAAATGAATTAGAACGACTGAAGAAAAGACAACAAAATAAGAAAGCATCA
AAACTAGATCCATTTAAAGAAATTATTGATAAAAAAATTTAA60
120
180
222
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000030 [new locus tag: EGJ38_RS00150 ]
- symbol: EGJ38_000030
- description: IS21 family transposase
- length: 73
- theoretical pI: 10.0835
- theoretical MW: 8810.2
- GRAVY: -1.15205
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: HTH (CL0123) TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 18)RNase_H (CL0219) Ydc2-catalyt; Mitochondrial resolvase Ydc2 / RNA splicing MRS1 (PF09159; HMM-score: 15.8)no clan defined PG_binding_4; Putative peptidoglycan binding domain (PF12229; HMM-score: 15.8)HTH (CL0123) HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 14.8)and 1 moreHTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9879
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0.0014
- Extracellular Score: 0.0102
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.018749
- TAT(Tat/SPI): 0.001085
- LIPO(Sec/SPII): 0.003796
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422042 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRHDIYEGVLFYLMKGIKPNYAELGRQYNCDPRTVKKYYEAGKENELERLKKRQQNKKASKLDPFKEIIDKKI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]