Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000433 [new locus tag: EGJ38_RS02160 ]
- pan locus tag?: SAUPAN002232000
- symbol: veg
- pan gene symbol?: veg
- synonym:
- alternate name: JSNZ_000433
- product: biofilm formation stimulator Veg
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000433 [new locus tag: EGJ38_RS02160 ]
- symbol: veg
- product: biofilm formation stimulator Veg
- replicon: chromosome
- strand: +
- coordinates: 465642..465905
- length: 264
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422429 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGCCAAAATCAATTTTGGACATCAAAAATTCTATTGATTGTCATGTAGGAAATCGTATT
GTACTGAAAGCCAATGGAGGCCGTAAGAAAACAATAAAACGTTCTGGAATTTTAAAAGAA
ACATATCCGTCAGTTTTCATTGTTGAGTTAGATCAAGACAAACACAACTTTGAGAGAGTA
TCTTATACATACACTGATGTGTTAACTGAAAATGTTCAAGTTTCATTTGAAGAGGATAAT
CATCACGAATCAATTGCACACTAA60
120
180
240
264
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000433 [new locus tag: EGJ38_RS02160 ]
- symbol: Veg
- description: biofilm formation stimulator Veg
- length: 87
- theoretical pI: 7.07163
- theoretical MW: 9998.21
- GRAVY: -0.591954
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: SH3 (CL0010) VEG; Biofilm formation stimulator VEG (PF06257; HMM-score: 108.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9907
- Cytoplasmic Membrane Score: 0.0016
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.007
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003095
- TAT(Tat/SPI): 0.00022
- LIPO(Sec/SPII): 0.000554
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422429 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MPKSILDIKNSIDCHVGNRIVLKANGGRKKTIKRSGILKETYPSVFIVELDQDKHNFERVSYTYTDVLTENVQVSFEEDNHHESIAH
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]