Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000697 [new locus tag: EGJ38_RS03480 ]
- pan locus tag?: SAUPAN002625000
- symbol: EGJ38_000697
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000697
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000697 [new locus tag: EGJ38_RS03480 ]
- symbol: EGJ38_000697
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 732940..733185
- length: 246
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422674 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241TTGATTTTCCTAACTTATTGGTGTGTTTTTCATTTAGCATACATAATAGGTTACATTAAA
ATAACATTTTATACCAAAGTACACCAAAAGAATATTAGTACACGAATTAAACAACATTTT
TATAGAAACCTATTGCACTTTAACGTCAATAAGTATATTTTTATATTATCTCTAATTAAT
TGTGCGCACTTAATAACAGAATATTCTCAATATTTTTATTTTTTTGTGATTTGTTGGGAT
ATTTAG60
120
180
240
246
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000697 [new locus tag: EGJ38_RS03480 ]
- symbol: EGJ38_000697
- description: hypothetical protein
- length: 81
- theoretical pI: 9.34945
- theoretical MW: 10087.9
- GRAVY: 0.503704
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined PRA1; PRA1 family protein (PF03208; HMM-score: 7.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6078
- Cytoplasmic Membrane Score: 0.1151
- Cell wall & surface Score: 0
- Extracellular Score: 0.2771
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009983
- TAT(Tat/SPI): 0.000209
- LIPO(Sec/SPII): 0.028035
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422674 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIFLTYWCVFHLAYIIGYIKITFYTKVHQKNISTRIKQHFYRNLLHFNVNKYIFILSLINCAHLITEYSQYFYFFVICWDI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000697 < queF < EGJ38_000699
⊟Regulation[edit | edit source]
- regulator: LexA (repression) regulon
LexA (TF) important in SOS response; regulation predicted or transferred from N315 and NCTC 8325 [2]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)