Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000813 [new locus tag: EGJ38_RS04060 ]
- pan locus tag?: SAUPAN001463000
- symbol: EGJ38_000813
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000813
- product: helix-turn-helix transcriptional regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000813 [new locus tag: EGJ38_RS04060 ]
- symbol: EGJ38_000813
- product: helix-turn-helix transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 840921..841106
- length: 186
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422788 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGCTGAACTTAAAAGAATTGAGAGAAGAAAAGGGGATAACACGCTATCAACTAGCGAAG
CTAACAGAATTACAAAATTCGACAATTCGATCTATCGAAACAGAAGTTAAAAATCCCGGC
TTCCTCACAGTAAAAAAAATATGCGATGCACTACAAGTTGATATCGCTAATGTAAAGGAG
AAATAA60
120
180
186
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000813 [new locus tag: EGJ38_RS04060 ]
- symbol: EGJ38_000813
- description: helix-turn-helix transcriptional regulator
- length: 61
- theoretical pI: 9.24218
- theoretical MW: 7003.14
- GRAVY: -0.445902
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 26.3)and 2 moreHypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 17.3)Mobile and extrachromosomal element functions Other probable addiction module antidote protein (TIGR02684; HMM-score: 12.8)
- TheSEED:
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 48.6)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 41.9)and 6 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 32.2)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 32.2)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 24.4)E-set (CL0159) Ig-like_Pom152_1; Nucleoporin pom152-like, first immunoglobulin-like domain (PF24519; HMM-score: 16.3)HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 14)HTH_Mga; M protein trans-acting positive regulator (MGA) HTH domain (PF08280; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8986
- Cytoplasmic Membrane Score: 0.0042
- Cell wall & surface Score: 0.0011
- Extracellular Score: 0.0961
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00598
- TAT(Tat/SPI): 0.000406
- LIPO(Sec/SPII): 0.00074
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422788 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLNLKELREEKGITRYQLAKLTELQNSTIRSIETEVKNPGFLTVKKICDALQVDIANVKEK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000813 > EGJ38_000814 > EGJ38_000815 > EGJ38_000816 > EGJ38_000817
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)