From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000857 [new locus tag: EGJ38_RS04280 ]
  • pan locus tag?: SAUPAN002982000
  • symbol: EGJ38_000857
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_000857
  • product: HK97-gp10 family putative phage morphogenesis protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000857 [new locus tag: EGJ38_RS04280 ]
  • symbol: EGJ38_000857
  • product: HK97-gp10 family putative phage morphogenesis protein
  • replicon: chromosome
  • strand: +
  • coordinates: 860090..860437
  • length: 348
  • essential: unknown

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422831 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAATATAGATGGATTAGACGCACTGTTAAACCAATTTCACGATATGAAAACCAACATT
    GATGATGATGTTGATGATATTTTACAGGAAAACGCCAAAGAATATGTAGTACGAGCTAAA
    TTGAAAGCTAGAGAAGTAATGAATAAGGGTTATTGGACTGGTAATTTATCACGCAATATC
    AGATATAAAAAAACTGGCGATTTGCAATACACTATCACATCGCATGCAGCTTATAGTGGT
    TTCTTAGAGTTTGGTACTCGATACATGGAGGCAGAACCTTTTATGTGGCCAGTATATGAG
    GTAATAAGAAAATCAACTGTAGAAGAATTGAAAGCGTTGTTTGAATAG
    60
    120
    180
    240
    300
    348

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000857 [new locus tag: EGJ38_RS04280 ]
  • symbol: EGJ38_000857
  • description: HK97-gp10 family putative phage morphogenesis protein
  • length: 115
  • theoretical pI: 4.9411
  • theoretical MW: 13465.2
  • GRAVY: -0.541739

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage protein, HK97 gp10 family (TIGR01725; HMM-score: 90.1)
    and 1 more
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides ubiquitin-like protein Pup (TIGR03687; HMM-score: 15.1)
  • TheSEED:
  • PFAM:
    Phage_tail (CL0348) HK97-gp10_like; Bacteriophage HK97-gp10, putative tail-component (PF04883; HMM-score: 51.9)
    and 2 more
    Histone (CL0012) TFIID_20kDa; Transcription initiation factor TFIID subunit A (PF03847; HMM-score: 13.9)
    no clan defined Pup; Pup-like protein (PF05639; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.2876
    • Cytoplasmic Membrane Score: 0.0513
    • Cell wall & surface Score: 0.0169
    • Extracellular Score: 0.6443
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006787
    • TAT(Tat/SPI): 0.000509
    • LIPO(Sec/SPII): 0.000575
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422831 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNIDGLDALLNQFHDMKTNIDDDVDDILQENAKEYVVRAKLKAREVMNKGYWTGNLSRNIRYKKTGDLQYTITSHAAYSGFLEFGTRYMEAEPFMWPVYEVIRKSTVEELKALFE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]