From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000869 [new locus tag: EGJ38_RS04340 ]
  • pan locus tag?: SAUPAN002996000
  • symbol: EGJ38_000869
  • pan gene symbol?:
  • synonym:
  • alternate name: JSNZ_000869
  • product: DUF2951 domain-containing protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000869 [new locus tag: EGJ38_RS04340 ]
  • symbol: EGJ38_000869
  • product: DUF2951 domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 872927..873226
  • length: 300
  • essential: unknown

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422843 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTTTGGATTTACCAAACGACATGAACAAGATTGGCGTTTAACGCGATTAGAAGAAAAT
    GATAAGACTATGTTTGAAAAATTCGACAGAATAGAAGATAGTCTTAGAGCGCAAGAAAAG
    ATTTATGACAAATTAGATAGAAATTTTGAAGAATTAAAGCGCGACAAGGTAGAAGATGAA
    AAGAATAAAGAAAAGAATGCCAAGAATATTAGAGACATAAAAATGTGGATTCTAGGTTTG
    ATAGGGACTATCTTCAGTACGATTGTCATAGCTTTACTAAGAACTGTTTTTGGTATTTAA
    60
    120
    180
    240
    300


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000869 [new locus tag: EGJ38_RS04340 ]
  • symbol: EGJ38_000869
  • description: DUF2951 domain-containing protein
  • length: 99
  • theoretical pI: 9.02274
  • theoretical MW: 12010.8
  • GRAVY: -0.737374

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 8.5)
  • TheSEED:
  • PFAM:
    no clan defined DUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 178.4)
    and 10 more
    XhlA; Haemolysin XhlA (PF10779; HMM-score: 19.9)
    MpPF26; M penetrans paralogue family 26 (PF07666; HMM-score: 17.4)
    TUNAR; TUNAR (PF21954; HMM-score: 15.6)
    TPR (CL0020) Sec3_C_2; Sec3 exocyst complex subunit (PF15278; HMM-score: 14.7)
    no clan defined TelA; Toxic anion resistance protein (TelA) (PF05816; HMM-score: 14.3)
    DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 13.6)
    YxiF; YxiF protein (PF24715; HMM-score: 13.6)
    Cyclin (CL0065) DUF3452; Domain of unknown function (DUF3452) (PF11934; HMM-score: 13.4)
    no clan defined DRAT; Dinitrogenase reductase ADP-ribosyltransferase (DRAT) (PF07357; HMM-score: 11.5)
    PBDC1; PBDC1 protein (PF04669; HMM-score: 11.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.78
    • Cytoplasmic Membrane Score: 8.16
    • Cellwall Score: 0.06
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0212
    • Cytoplasmic Membrane Score: 0.8518
    • Cell wall & surface Score: 0.0017
    • Extracellular Score: 0.1254
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002331
    • TAT(Tat/SPI): 0.000943
    • LIPO(Sec/SPII): 0.00094
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422843 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRAQEKIYDKLDRNFEELKRDKVEDEKNKEKNAKNIRDIKMWILGLIGTIFSTIVIALLRTVFGI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]