Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000878 [new locus tag: EGJ38_RS04385 ]
- pan locus tag?: SAUPAN003007000
- symbol: EGJ38_000878
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000878
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000878 [new locus tag: EGJ38_RS04385 ]
- symbol: EGJ38_000878
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 880173..880358
- length: 186
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422852 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAGTGATTATAAATTAAAAATAATTGAATTGATCAAAAGTGATATAACAGGTTACCAA
ATTCACAAACAAACTGGCGTAGCGCAATATGTAATTTCACAATTAAGGCAAGGAAAGCGC
GAAGTAGATAACTTAACTTTAAATACAACTGAAAAACTATACAGTTACGCACGACAAGTG
TTATAA60
120
180
186
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000878 [new locus tag: EGJ38_RS04385 ]
- symbol: EGJ38_000878
- description: hypothetical protein
- length: 61
- theoretical pI: 9.75724
- theoretical MW: 7104.14
- GRAVY: -0.452459
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: HTH (CL0123) HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9528
- Cytoplasmic Membrane Score: 0.001
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.0449
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008307
- TAT(Tat/SPI): 0.000459
- LIPO(Sec/SPII): 0.00131
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422852 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSDYKLKIIELIKSDITGYQIHKQTGVAQYVISQLRQGKREVDNLTLNTTEKLYSYARQVL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000877 > EGJ38_000878
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)